KEGG   Schizosaccharomyces pombe (fission yeast): SPAC13G7.12cHelp
Entry
SPAC13G7.12c      CDS       T00076                                 

Definition
choline kinase (predicted) (EC:2.7.1.32)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPAC13G7.12c
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     SPAC13G7.12c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(2316467..2317837)
Genome map
AA seq 456 aa AA seqDB search
MVNFASEVDKNNAFDSAHPSRKCKGSLDCNDPDPIFRHKVLVIIHKLAISSWNRIPLTLC
NKLHIKRISGALTNAVYYVAPPEGYHAPKLLLRIYGPHVELFINRQVELENLKRLARHNI
GPYLIGEFSNGRFEQYMESTTLTCKTIRDPKLSIYVGRRLCELHNFILLHPHEVLEMPAA
WKNCLVWLPKAKAKILGRKHSLAITSEFMKTLEEDFNAYYNWFVEWSRDKKDWFGLKMVF
SHNDTQYGNLLKIKAKKRSIPLSQKHRTLVPVDFEYAGPNLCAFDLANYFAEWMADYHHP
THNYLMDRSRYPDFNARKLVYHAYVEQSAVINDLLEIEDASLLKTDISDELKNTFEKQIM
NLEESVRAISPAANIGWALWGILQCLEEDDEWEDLSVSSQVADRPEKQLVEGSTVPPIGT
SSFDYIGYSSEKFDLFYEGCAALGLNGRNRSTFSYA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggtcaattttgcttctgaggttgacaagaataatgcctttgattcggctcacccttct
cgaaaatgtaaaggatctttggattgtaatgaccctgatcccatttttcgtcataaggtt
ttggtaataatacacaaacttgctatttctagttggaatcgtattccgttaacattgtgt
aacaagttacacatcaaaagaatttcaggagctttaactaatgctgtctattatgtggca
ccgccagaaggttaccacgctcccaaactgttactacggatttatggtccccatgttgaa
ttgtttattaatcgacaagttgaactggaaaacttgaagcgccttgctcgacacaatatt
gggccttatttaattggcgagttttccaatggccgctttgaacaatatatggaatcaact
actttgacctgcaaaacaattcgcgatcccaaactttctatctatgttggccgtagactt
tgtgagttacacaattttatccttttacacccccatgaagttctcgaaatgcctgctgct
tggaaaaattgcttggtatggcttccgaaagcaaaagcaaaaatacttggtagaaagcac
tccttagcaattactagtgaatttatgaaaactttggaagaagactttaacgcttattac
aattggtttgttgaatggtcgcgtgataaaaaagattggtttggtttaaaaatggttttc
tctcataatgatactcaatatggcaacctcttgaaaattaaagctaaaaaacgttctata
cctctttcccaaaagcatcgaacccttgtacctgttgattttgagtatgctgggccaaat
ctttgtgcttttgatttagctaactattttgctgaatggatggccgactatcatcatcca
acccataattatttgatggaccgctcaaggtatccagattttaatgctcgaaagttggtt
tatcacgcatatgttgagcaatccgctgtcattaatgatctactcgaaattgaagatgct
tcattgttgaaaactgatatttccgacgaattaaagaacacgtttgaaaagcaaattatg
aacttagaagaatctgttcgcgcaattagtcctgctgcgaacatcgggtgggcattgtgg
ggaattttacaatgcttggaagaagatgatgaatgggaggatctaagcgtttccagccaa
gttgcggatcgacctgaaaaacagttggttgaaggttctaccgtccctcctattggtacc
tcttcttttgactatattggatacagctctgaaaaatttgatctgttttacgagggatgt
gctgccttaggcctaaacggtcgaaaccgttctacattttcgtatgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system