KEGG   Schizosaccharomyces pombe (fission yeast): SPAC144.13cHelp
Entry
SPAC144.13c       CDS       T00076                                 

Gene name
srw1, ste9
Definition
CDK inhibitor Srw1
Orthology
K03364  
cell division cycle 20-like protein 1, cofactor of APC complex
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC144.13c (srw1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC144.13c (srw1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    target recognizing subunit
     SPAC144.13c (srw1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(4678386..4680056)
Genome map
AA seq 556 aa AA seqDB search
MDEFDGFTRPTSSNSSANRNSNNSMNRVENNNSNSDSANTVDSRGDAHTRMRQGFEKSFP
SSPNKKRPRTNEGDRFIPSRDASTELWTGFTKVEGPLTPVKKKQSVADRNFTTLLRSELF
GSNDETFNNSPIATPNTTIGVSTPRTDSGIDDIELTQRTPPSSSHTSSSILQNTPVTPSR
KIFHYLSPRDRNKSSYGKKAQYQDNPNRTIYSLSPVRSITKDLISASRLEGRELPSIPYR
VLDAPGLAGDFYLNLLDWGQCNMLAVALASRVYLWSGISSEVTVMHNFYPTDTVTSLRWV
QRGTHLAVGTHNGSVEIWDAATCKKTRTMSGHTERVGALSWNDHVLSSGGRDNHILHRDV
RAPEHYFRVLTAHRQEVCGLEWNSNENLLASGGNDNALMVWDKFEEKPLYSFHNHIAAVK
AITWSPHQRGILASGGGTADRTIKLWNTQRGSMLHNIDTGSQVCNLLWSKQTNEFISTHG
FMENEVALWNYPSVSRVGTLKGHTDRVLYLAMSPNGENIVTGAADETLRFWKLFDSKSKH
SASTMSSPFDPTMKIR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggatgaatttgatgggtttactagacctacttcatcgaattcgtctgctaatcgaaat
tcaaataatagcatgaatcgtgttgaaaataataactctaattccgattctgctaacacg
gttgattcaagaggcgatgctcatactcgaatgcggcaaggtttcgaaaaatcgtttcct
tcttctcctaacaagaaaagacctcgcacaaacgagggagatcgattcattccttctagg
gatgcttctacggaattatggacaggttttactaaagttgaaggacctttgactccagtt
aaaaaaaagcaatccgtggcggatcgcaacttcaccacactcttaagaagcgagttgttt
ggttccaatgatgaaacttttaataattctccaattgctactcctaacactacgataggg
gtttcaacaccccgtactgattctgggatagatgatattgaacttactcaaagaacgcca
ccttcttcctctcacacttcttcttctatacttcaaaacacgcctgttacaccttctcga
aagatatttcactatttatctcctcgtgaccgaaataaatcgtcatatggaaagaaagcg
caatatcaggacaacccgaatcggacaatttattctttgtcgcctgtgcgctctattact
aaagatttaatttctgcaagtcgactggaagggagagaactcccttctataccttacaga
gtacttgacgctcctggccttgctggtgatttctacctgaatcttttagattggggccaa
tgtaatatgttagcggttgctttggcttctcgagtttatttgtggtcagggatctcaagc
gaagtaacagttatgcacaacttttatccaacagatacggtcacatcactcaggtgggtt
cagcgtggcactcaccttgctgtgggcacacacaatggctctgttgaaatttgggatgcc
gcgacttgtaaaaagacgagaactatgtctgggcacactgaacgggtcggtgccctatct
tggaatgatcatgtgttaagtagtggtggtcgagataaccatattcttcaccgtgatgtt
cgtgctccagagcattattttcgagttttgacggcgcatcgacaagaagtgtgtggtctt
gaatggaattccaatgaaaatttacttgcttcaggtggaaatgataatgcccttatggtg
tgggataaatttgaagaaaaacctttatattcctttcataatcatattgcagctgtaaag
gcaataacttggagtccacatcagcgcggaattctggcttctggaggaggtactgccgat
cgcaccataaagttatggaatacacaacgcggatcgatgttgcacaacatagacacagga
tcacaagtctgtaatttgttgtggtcaaagcaaacaaacgaatttatttcaactcatggt
ttcatggaaaatgaagtagctttgtggaactatcctagtgtttcacgtgttggaacctta
aaaggtcatacagatcgagttttgtatttggctatgtctcccaatggtgaaaatatagtt
actggtgcagccgatgaaacacttcgattctggaagctgtttgattctaaatcaaaacac
tccgcttccactatgagttctccatttgaccctacaatgaaaatacggtaa

DBGET integrated database retrieval system