KEGG   Schizosaccharomyces pombe (fission yeast): SPAC167.07cHelp
Entry
SPAC167.07c       CDS       T00076                                 

Definition
(RefSeq) ubiquitin-protein ligase E3 (predicted)
  KO
K10589  
ubiquitin-protein ligase E3 C [EC:2.3.2.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC167.07c
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     SPAC167.07c
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  HECT type E3
   SPAC167.07c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1546504..1549487,1549546..1549602,1549647..1549695)
Genome map
AA seq 1029 aa AA seqDB search
MPLSFEGTFKAKRNVNLGGKRVSNDRAQLLRKAAMERKNREEERKAENNSVAVQSLSRGF
LARRKFKQDFRERWIYKYTKSGRTSIRFNTLEDIKCSISLLVLFAEPDIDLPFVSQVAHN
ILVWLENLIPLSNGMDDTPKSHLKVKILKVQETLSNSNDSWLWQRFSSLLLNCLVSSINS
HRIEGTDTSAETSLLHCLAYVAPYLKSSELSTYYDSVMTFYAQIYPKQNMTNLEDIMSLS
LLTPVSSKTDENANSSSAFLFHVLASDCFSSIENCIPPDLIIDKVFSSSLQLSEEACISS
LLNLGMIKVFSLAGNCLHLLHTEYKNSSLWKFCSYILDALYVFSGESVNSRIQVVSDVDD
DEDDENAFSQNYYSHLQMVAKHFSKNYANQSGIVQRSFAECISSTFITKAFKLVSSNTLQ
AMSHFYATMIKLFPSNRTSILMYISLVETNEGSLTRSFSRFSWDMFSESPVYQLFHKKFD
VQNVLKNDSGYWFQLQLLIDVYSRMLFTMIDDEFHNDKQNPLYPVMAEFCTVLKNLVLGL
YWDVQAAKDVDCKSVVDISQLRVSSTSLLQQLYRINSRKQFLPEDFFLMSEYFNLNEFEA
NALQESELASHAEAEINITYKFDNFSESRPRLNILNNCSFFLPFHFRIHLLQQLLLLDKQ
ANGYAQPFGHLKHAVIRRNRIFDDGFDAFYNFGKLLKGPIRITFVDEHGVVEEGIDGGGL
TKEFLTSICKTVFDINYGLFSETKAHLLYPNTHAYAQDVERLRCYEFLGMLIGKCIYEGI
QIDAAFASFFVAKWLGHPSYFDDLTSLDPNLYEGLVFLKNYDGDVENDMALNFTVVHEEF
GVRNVIDLIPNGSNISVTNENRLQYIHLVSNYYLNARLSRQCRAFTNGFTQIIDPHWLAM
FHESEIQILVGGDPVPIDIDDLRRHTVYAGGYEPNSPTIVLFWEVLREFEEEDKRSFVKF
VTSVARPPILGFKALMPSFCIRVNGEDETRLPTASTCVNLLKLPMYSTKQTLRDKLLTAV
RSGVGFGFS
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaagttttgaaggaacgtttaaagccaaaagaaatgttaatctcgggggaaaa
cgtgtctccaacgatcgcgctcagttgttgcgaaaagcagccatggagcgcaaaaatcga
gaagaagaacgaaaagcagaaaataattctgttgccgttcaatccttgtctagaggtttt
ttagctaggcgaaaatttaaacaagatttccgggagcgctggatatacaaatacacaaaa
tcagggcgtacatctatcagattcaatactttggaagatataaaatgctctatttctctt
cttgttttatttgctgagcctgatatcgacttgccatttgtttctcaagttgcgcataat
atactggtttggctggaaaatttaattcctctatcgaatggaatggatgatacaccaaaa
agccacctaaaagtgaaaatattaaaagtacaagagacgttatccaactcaaatgactcc
tggctatggcagaggttttcatctttgctactaaattgcttagtcagttctattaattca
cataggatagagggtactgatacatctgccgaaacatctctccttcattgtttggcatac
gtggcgccttaccttaaaagttctgaattatctacgtattatgactctgttatgactttt
tatgctcaaatataccctaaacaaaatatgactaatcttgaagatattatgtctctatct
ttacttacacctgtcagctctaaaactgatgagaatgcaaatagcagttcggctttttta
tttcatgtccttgcgtcggactgttttagctcaattgaaaactgtataccaccagatcta
ataattgataaagttttctcttcgtctttgcaattatccgaagaagcctgcatttcttct
ttattaaatttggggatgataaaagttttctctttagctggaaactgtcttcatttgttg
cacacggaatacaaaaacagttctttatggaaattctgctcttatatcttagatgcacta
tatgttttctcaggagaatctgtaaattctcgaatccaagtggtcagtgatgttgacgat
gatgaagacgatgaaaacgcattttcccaaaattattatagccatcttcaaatggttgct
aaacatttttctaaaaattacgcaaatcaatctggtatagttcagcgatcgtttgcagaa
tgtatatcttctacttttataacaaaagctttcaaattagtgtcatctaatactttacaa
gctatgtcacatttttatgcaaccatgataaaactttttccatccaaccgaacatcaatt
cttatgtatatatccttagtagaaactaacgaaggctcattgactcgttctttttcacgt
ttttcttgggatatgttttccgaatcgcctgtttatcaattgttccataagaagtttgat
gttcaaaatgtcttaaaaaatgattccggctactggtttcaactacaattactaattgat
gtttactcacgcatgctttttaccatgatcgacgatgagtttcataacgataagcaaaat
ccgctttatccagttatggctgagttttgtactgttttgaaaaatctagttttaggtttg
tactgggatgttcaagctgctaaagatgttgactgtaaatctgtggttgatatttctcaa
ttaagagtctcgtcaacttcccttttacaacagttatataggataaattcaagaaaacaa
tttcttccggaagatttctttttgatgagtgaatatttcaatttgaatgaatttgaagct
aatgcactacaagagtcagagttggcttcacatgctgaagcggaaattaatattacttac
aaattcgataacttcagcgagtcccgaccaaggctaaatatcctaaataactgttctttt
ttccttcccttccattttcgcattcatttgcttcagcaactacttcttttagataaacaa
gctaacggttatgcccagccgtttggtcatctaaaacatgcagttattcgtcgaaatcgt
attttcgatgatggatttgacgctttttacaattttgggaagttacttaaaggtcctatt
cgaattacatttgtagatgaacatggtgttgttgaagaaggtatcgatggaggtggtctt
accaaggagtttttaacaagtatatgtaaaactgtttttgacattaattatgggcttttt
agtgagacaaaggctcatttgttatatccaaatactcatgcatatgctcaagacgttgaa
cgattgcgctgttatgaatttttagggatgctaattggaaaatgcatttacgaagggatt
cagattgatgcagcgttcgcatctttttttgtcgctaaatggcttgggcatccaagttat
tttgacgatcttactagccttgatccaaacttatatgaaggattggtatttcttaaaaac
tacgatggagacgtagaaaatgatatggctctcaattttacggttgttcatgaagagttt
ggtgttcgtaacgtaattgacctaattccaaatggaagcaacatttcggttacgaatgaa
aatcgtttacagtatattcatttggtttccaattattatttaaatgcaaggctatctaga
caatgtcgtgcgtttaccaacggattcactcaaattatcgatccacactggttagcaatg
tttcatgaaagtgaaattcaaatactagttggtggtgatcctgtaccgattgacattgac
gatttacgccgacataccgtttatgctggaggctacgaaccaaattcacctactattgtt
ttattttgggaagttttacgagagttcgaagaagaagacaaaagaagctttgttaagttt
gttactagcgttgctcgtccaccaattttgggatttaaagcgcttatgccttctttctgt
attcgtgtaaatggggaagatgaaacacgattaccaactgcaagtacttgtgtaaacctt
ttaaagctgccgatgtatagtacaaagcaaacgttgagagataaattattaaccgcagta
aggtcaggtgttggttttggctttagttaa

DBGET integrated database retrieval system