KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1687.05Help
Entry
SPAC1687.05       CDS       T00076                                 

Gene name
pli1
Definition
SUMO E3 ligase Pli1
Orthology
K04706  
E3 SUMO-protein ligase PIAS1 [EC:6.3.2.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC1687.05 (pli1)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     SPAC1687.05 (pli1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(908839..908871,908924..911074)
Genome map
AA seq 727 aa AA seqDB search
MNQANFLQELPNVLKRLETGLIIPQLKDILRVFGLRLSGTKAELITRIKQLIERIAIENN
TTSWEALKKAIDGDVTSAVCILKYNTYQIYSAAAPIAPPSSASGNRSYSRPFAPVVHSRI
RFRKSPFYDILEQFNAPFVVPACVGTRNTISFSFHVTPPALSKLLNDPKQYRVYLFSTPS
ETIGFGNCLMEFPTPQMELRINNQVAHANYRRLKGKPGTTNPADITDLVSKYAGPPGNNV
VIYYMNSTKSYSVVVCFVKVYTIENLVDQIKSRKAESKEKIIERIKNDNQDADIIATSTD
ISLKCPLSFSRISLPVRSVFCKHIQCFDASAFLEMNKQTPSWMCPVCASHIQFSDLIIDG
FMQHILESTPSNSETITVDPEGNWKLNTFDEPVESSEDEFVPKEKVIELSDGEGISTMAN
KSNDQPTRRASTHNSGPPAKRKRESLVIDLTISDDDENVATSTTESPSNATKENSLSRNV
QSPNIDTAISNRSTNVRHGHPGFKDYTVENSPASRERSTSESAQSSVHMGYAGEGGLLSG
ALRAPSQQNNNNSNTQHSINLHTIVPSPYEPPLSVTPSTAITNLSIPESNRTNSSASSKS
FTMNDLILPPLHLKNTTQTNNAHEDAQSSNLSQNHSLFYERIPQRPSYRIEKQNKGIYED
ENEQSISAMPIPRAHPQLPKNLLSQTAGPLWDEQQDAQVDWNSELQSNNSYHNSGFEGTG
NTFQSID
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggcgaactttttacaggagcttccaaatgtactaaagcgactggaaactggt
cttattatacctcaactgaaagatatacttcgtgtttttggacttcgtctttcaggaaca
aaagctgagctcattaccagaattaaacaactaatagagaggatagctatagaaaacaac
acaacctcttgggaagcattgaaaaaggcaatcgatggcgatgttacaagtgccgtatgt
atcttaaagtacaacacatatcagatatatagtgctgctgctccaattgctccacctagt
tcagcttctggaaatagatcatacagccgtcctttcgccccagttgttcattcgcgaata
cgatttcgaaaaagtcccttttatgacattttggaacaattcaatgcacctttcgttgta
cctgcttgtgtcggcactcgtaatactatctccttctcttttcatgtaactccccctgct
ctatcaaaattacttaatgatcctaaacaatatcgtgtttatcttttttctacgccctca
gaaaccataggcttcggtaattgcttaatggagtttccaactcctcaaatggagttgcgt
ataaataatcaagttgctcatgctaattatcgaaggctgaaggggaaacctgggacaaca
aatccggctgacataaccgatttagtctccaagtacgccggtcctcctggtaataacgtt
gtcatttactatatgaattctacaaaaagctattctgttgtggtttgctttgttaaagtg
tatacaattgaaaaccttgtggatcaaataaagagcagaaaagctgagtcaaaagaaaaa
attattgagcgtataaaaaatgacaatcaggatgccgatattatcgctacatcaactgat
atatctttaaagtgccccttgtctttttctcgaatatcactaccagtgcgatctgtattt
tgtaagcatatccaatgctttgatgcttctgcttttctagaaatgaataaacagacacct
tcttggatgtgtccagtatgcgcttcccatatccagttttccgaccttataattgatggt
tttatgcaacatattttagaaagtactccaagcaattcagaaactattactgttgatccc
gaaggaaactggaaactaaatacgtttgatgaacccgtcgaaagctcggaagatgaattt
gtaccaaaagaaaaggtaatcgaattgagcgatggggaaggtatctctacgatggctaac
aagtccaatgatcaacctacgaggagggcatctactcataattctggtccacctgcaaag
aggaaacgtgagtcacttgtaattgatttaacaatatctgatgatgatgaaaatgtggca
acatccacgacggaatcgccatctaatgctacaaaggagaactctttgagtcgaaatgta
cagtcacctaacatcgacactgccatatcgaacaggtcaacaaacgtcagacatggtcac
ccggggttcaaagactacacggttgaaaactccccagcatcaagagagcgttctacaagt
gaaagcgctcaatcctctgtccatatgggatatgctggcgaaggcggactgttatccggt
gctttaagggccccttctcaacaaaataataacaattcgaatacacagcactcaataaac
ttacatacaatagtgccgtctccttatgaaccacccttatccgttactccttcaacggca
attactaatctctccataccagaaagtaacaggactaattcatctgccagttctaaaagc
ttcaccatgaatgatttaattcttccaccgttgcacttgaaaaatacaactcaaactaat
aacgcacatgaggatgcccagtcgtccaatctctctcaaaaccatagtctgttttatgaa
agaataccccaacgaccctcttatagaattgaaaagcaaaataagggtatatatgaagat
gagaatgaacaaagtatttctgcgatgcccatacctcgagcacatcctcaactgccaaag
aatttgttgtcgcagacggctggaccgctgtgggatgaacaacaagatgctcaagtagac
tggaattctgagttacagtcaaataactcctatcataattccggatttgaaggaacggga
aacacttttcagagtatagattaa

DBGET integrated database retrieval system