KEGG   Schizosaccharomyces pombe (fission yeast): SPAC16E8.15Help
Entry
SPAC16E8.15       CDS       T00076                                 

Gene name
tif45, tif1
Definition
translation initiation factor eIF4E, 4F complex subunit
Orthology
K03259  
translation initiation factor 4E
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPAC16E8.15 (tif45)
Translation factors [BR:spo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SPAC16E8.15 (tif45)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(3528159..3528385,3528454..3528628,3528763..3529017)
Genome map
AA seq 218 aa AA seqDB search
MQTEQPPKESQTENTVSEPQEKALRTVFDDKINFNLKHPLARPWTLWFLMPPTPGLEWNE
LQKNIITFNSVEEFWGIHNNINPASSLPIKSDYSFFREGVRPEWEDVHNKTGGKWAFQNK
GRGGNALDEMWLTTVLAAIGETLDPTGQEVMGVVINMRKGFYRLAVWTKSCNNREVLMEI
GTRFKQVLNLPRSETIEFSAHEDSSKSGSTRAKTRMSV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcagactgaacaaccaccaaaagagtcacagaccgaaaataccgtgtcagaaccgcaa
gaaaaagctctgcggacggtttttgatgacaaaataaattttaatttgaagcatcctctt
gctagaccatggactttgtggtttttaatgccacctactcctggcttggaatggaatgaa
ctgcaaaagaacataattacttttaatagcgtagaagagttttggggaatccataacaat
atcaatcctgcatctagcttgcctattaagtctgattattcttttttccgtgaaggagtt
cgtccagaatgggaagacgtccataataagactggaggtaaatgggcttttcagaataaa
ggccgtggaggaaacgctttagatgagatgtggttaactacggttctcgcggccatcggt
gaaactctcgatcctacaggccaagaagtaatgggtgtagttattaacatgcgtaaagga
ttttaccgtctagcagtttggaccaagagttgcaacaatcgtgaagtgcttatggaaatt
ggtactcgttttaagcaagttctcaacttaccccgatcggaaactatagaatttagcgct
catgaagattcttccaagtctggtagcactcgcgccaaaactcgcatgagtgtttaa

DBGET integrated database retrieval system