KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A5.13Help
Entry
SPAC17A5.13       CDS       T00076                                 

Definition
GTP cyclohydrolase (predicted) (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPAC17A5.13
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SPAC17A5.13
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1776500..1776608,1776662..1776957,1777069..1777371)
Genome map
AA seq 235 aa AA seqDB search
MEPGKKDYIDSPLRMQPASLSGASTPTIDLDGLSWPCQGTQRRIDTAEEEKVKKISNAIS
TILECLGEDPERQGLLGTPERYAKAMLYFTKGYEQNLTEVINEAVFQEDHEEMVIVRDID
VFSLCEHHLVPFIGKIHIGYIPRKRVLGLSKLARIANMFSRRLQVQERLTKQVAQAIQAV
LKPQGVAVVMEATHMCMVMRGVEKPGSSTVTSSLTGIFQRSHKTREEFFRLIGKF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggagcctggaaaaaaggattatatagattctcctttgaggatgcaaccagcctcactt
tctggcgcatctacaccaactattgatttagacgggctttcttggccttgtcaaggaaca
caacgtagaatagatactgctgaggaagaaaaagtaaaaaaaatttccaatgctatttca
acaattttggaatgtttgggagaagatcctgagagacaaggccttttgggaacacctgag
aggtatgccaaggcaatgctttactttaccaaaggatacgagcaaaatttgaccgaagtg
atcaatgaggcagtatttcaagaagatcacgaagaaatggtcattgttagagatattgat
gtattcagtttgtgcgagcatcatttggttccttttattggaaaaattcatattggttat
attcctcgtaagcgtgtattgggactttcaaagctcgcacgtatagccaatatgttttcg
cgtcgcctacaggtgcaggagcgtcttaccaaacaagttgcccaagctattcaagctgtc
ttaaaacctcagggagttgcagtcgttatggaagctactcatatgtgcatggttatgcgc
ggtgttgaaaaaccgggtagcagtactgttactagtagtcttactggtatatttcagaga
agccataaaactagggaggagttttttagattgattggaaaattttaa

DBGET integrated database retrieval system