KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17C9.01cHelp
Entry
SPAC17C9.01c      CDS       T00076                                 

Gene name
nuc2, apc3, SPAC1851.01
Definition
anaphase-promoting complex subunit Apc3
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:spo04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(4498132..4498435,4498481..4498651,4498758..4500280)
Genome map
AA seq 665 aa AA seqDB search
MTDRLKCLIWYCIDNQNYDNSIFYSERLHAIEDSNESLYLLAYSHFLNLDYNIVYDLLDR
VISHVPCTYLFARTSLILGRYKQGISAVEACRSNWRSIQPNINDSISSRGHPDASCMLDV
LGTMYKKAGFLKKATDCFVEAVSINPYNFSAFQNLTAIGVPLDANNVFVIPPYLTAMKGF
EKSQTNATASVPEPSFLKKSKESSSSSNKFSVSESIANSYSNSSISAFTKWFDRVDASEL
PGSEKERHQSLKLQSQSQTSKNLLAFNDAQKADSNNRDTSLKSHFVEPRTQALRPGARLT
YKLREARSSKRGESTPQSFREEDNNLMELLKLFGKGVYLLAQYKLREALNCFQSLPIEQQ
NTPFVLAKLGITYFELVDYEKSEEVFQKLRDLSPSRVKDMEVFSTALWHLQKSVPLSYLA
HETLETNPYSPESWCILANCFSLQREHSQALKCINRAIQLDPTFEYAYTLQGHEHSANEE
YEKSKTSFRKAIRVNVRHYNAWYGLGMVYLKTGRNDQADFHFQRAAEINPNNSVLITCIG
MIYERCKDYKKALDFYDRACKLDEKSSLARFKKAKVLILLHDHDKALVELEQLKAIAPDE
ANVHFLLGKIFKQMRKKNLALKHFTIAWNLDGKATHIIKESIENLDIPEENLLTETGEIY
RNLET
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcgattgaaatgtttaatatggtattgcattgataatcagaattatgataat
tcaattttttattcagaacgtttacatgcaattgaagattcaaacgagagtttgtatctt
ttggcatattcgcatttcctaaacctcgattacaatattgtatacgacttattagataga
gtaattagtcatgttccttgcacatacttatttgcaaggaccagccttattttaggcaga
tataaacaaggaataagtgctgtggaggcctgtcgatcgaattggcgctccattcagcca
aacataaatgactcaattagcagtcgtggacatccagatgcctcttgcatgcttgatgtt
ttgggtactatgtataaaaaggcagggttcctcaaaaaagctacagattgttttgtagaa
gctgtctccattaacccatataatttctctgctttccagaatttaactgcaataggcgtg
ccactcgatgctaataatgtatttgttattccaccctaccttacggcaatgaagggtttt
gaaaaatctcaaacgaatgctacagcttcggtaccagaaccgtcttttttgaagaaaagt
aaagagtcttcctcatcttccaacaagttttcggtttctgaatcgatagcaaatagttat
tcaaactcatccatttcagcatttactaagtggtttgatagggttgacgcttctgagctt
ccaggaagtgagaaggaacgacatcaaagcttgaaattacaatctcaatctcagactagc
aaaaaccttttggctttcaatgatgctcaaaaagctgattctaacaatagggatacgtct
ttaaaatcccactttgtggaacctagaacccaagcattaagaccaggagctcgtttaaca
tataaattacgcgaagcgagaagttctaaaagaggagagagcacacctcaaagcttccgc
gaagaggacaataatttgatggaattactaaagttattcggtaagggtgtttacctgctc
gcccagtataagttacgagaggctttaaattgtttccaaagcttgcccatcgaacagcaa
aatacaccttttgttcttgcaaagcttggaataacctactttgaactggttgattacgaa
aaatctgaagaagtgtttcaaaaattaagggacttgtcgccttcacgtgtcaaagatatg
gaagtcttttcaactgcactttggcatttgcaaaagtctgttcctttatcttaccttgcc
catgaaactttggaaactaatccttattccccagaatcatggtgcattcttgctaattgc
ttctcacttcaacgtgaacactcgcaggcattaaaatgtattaatagagctattcaattg
gatccaacttttgaatatgcttatacgcttcaagggcacgagcattctgcaaacgaagaa
tacgaaaaatcgaaaacatctttccgcaaagcaattagagtaaatgttcgacattacaat
gcatggtatggcctgggaatggtttatttaaaaacagggcgaaatgatcaagcagacttt
cattttcaacgtgctgcagagatcaatcctaacaactctgtactcatcacttgtattggt
atgatttacgaacgctgcaaagattacaaaaaagcacttgatttttatgatcgggcatgt
aaactggatgaaaagtcttcgcttgccaggttcaagaaagccaaagtgcttattttatta
catgatcacgataaagcactcgttgaattggaacaattaaaggcaattgcgccagatgaa
gcaaatgttcattttttgctcggcaaaattttcaagcaaatgcggaaaaaaaatttagcc
ttaaagcacttcactatagcatggaacttagacggcaaggctacgcatattattaaggaa
tcgattgaaaatctggatattcccgaagaaaatttgttaactgaaacaggtgaaatttat
aggaatctggaaacttaa

DBGET integrated database retrieval system