KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17G6.12Help
Entry
SPAC17G6.12       CDS       T00076                                 

Gene name
cul1, pcu1
Definition
cullin 1
Orthology
K03347  
cullin 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-BTRC complex
SCF-CDC4 complex
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC17G6.12 (cul1)
   04120 Ubiquitin mediated proteolysis
    SPAC17G6.12 (cul1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC17G6.12 (cul1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    Cullin
     SPAC17G6.12 (cul1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(3612124..3612191,3612237..3612323,3612422..3612486,3612598..3612674,3612877..3614883)
Genome map
AA seq 767 aa AA seqDB search
MTTLNTNDKDLPIVKKYDSLNGTWDFLKTGVSQIFERLDEGMTITKYMELYTAIHNYCAD
ASKTITVDNFNDQTANVLGEALYNNLVLYLEEYLARLRKECISQTNHEEQLAAYAKYWTR
FTTSARFINHLFGYLNRYWVKLKNRFTETLVYDIYTLCLVSWHHHVFSHIRDSLLQNLLY
MFTKKRLYEPTDMKYVEVCVDSITSLSFDKTDMTKPNLSSYKTFFETNFIENTKNFYAKE
SSEYLASHSITDYLKKAEIRLAEEEELVRLYLHESTLKPLLEATEDVLIAQHEEVLHNDF
ARMLDQNCSEDIIRMYRLMSRTPNGLQPLRQTFEEFVKRSGFAAVAKIVPQVGGEADVDP
KEYMEMLLSTYKASKELVNTAFHGDTDFTKSLDTAFRELVNRNVVCQRSSSRSPELLAKY
ADSILRKSNKNVDIDDVEDCLSSIIIIFRYVEDKDVFQNFYTKLLAKRLVNGTSNSQDAE
SSMLSKLKEVCGFEYTSKLQRMFQDISLSQEITEAFWQLPQSRAGNIDFSALVLGTSFWP
LSPNNVNFHLPEELVPLYEGFQNYYYSCHNGRKLSWLFHLSKGEIKARINPQTNVTYVFQ
VSTYQMGVLLLYNHRDSYTYEELAKITGLSTDFLTGILNIFLKAKVLLLGDNDKLGDPNS
TYKINENFRMKKIRVQLNLPIRSEQKQESLETHKTIEEDRKLLLQSAIVRIMKARRTLKH
VVLVKETIDQIKSRFTPKVSDIKQCIDMLIEKEYLERQGRDEYIYLA
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgactactttgaataccaacgataaagacctcccgattgttaaaaaatatgattcattg
aatggaacttgggactttttaaaaacaggtgtgtcccaaatatttgaaaggctagatgaa
ggaatgactatcactaagtatatggagctttatacagcaatccataactactgtgctgat
gcgtccaaaactataacggtggacaatttcaacgatcaaactgcaaacgttttaggcgaa
gccctttacaataatttggttctatatctggaagagtatttggcccgtctgcgaaaggaa
tgcatttcgcaaacgaatcatgaagagcaactcgctgcgtatgccaagtattggacgcga
tttacaacatctgcccgttttatcaaccatctttttggatatttaaatagatattgggtt
aaactgaagaacagatttactgagacactcgtgtacgacatttacacactttgtcttgtg
tcatggcatcatcacgttttttcccacattcgcgatagcctacttcaaaatttgttatac
atgttcaccaaaaaaagattatatgaacctactgatatgaaatatgtggaagtttgtgtg
gattctatcacttcattgagctttgataaaaccgatatgacaaagcctaacttgagctca
tacaaaacttttttcgaaacaaactttattgaaaatacaaaaaacttttatgcaaaggag
tcttccgaatacttggcttcccattctattacggattacttaaaaaaggcagaaataaga
ctagcagaggaggaagagcttgtgagattatatttgcatgaatccacattgaagccgctt
ttagaagcgactgaagatgtactaattgcacaacatgaagaagttttgcacaacgacttt
gcacgcatgctcgaccaaaactgcagtgaggatatcattcgcatgtaccgattgatgtct
cgaacacctaatgggttgcagcctttacgccagacatttgaggagtttgtcaagagatca
ggctttgctgcggttgccaaaattgttccccaggtcggtggagaagccgatgtggatcct
aaagagtatatggaaatgttactttccacgtataaagcttccaaagaacttgttaacacc
gcatttcatggggatactgattttacaaagtcattggatacagcctttagagaacttgtc
aatcgaaatgttgtttgccagcgctcttcctctcgctccccagagttgcttgctaaatac
gccgacagtattttgcgaaaaagcaacaagaatgttgacattgatgatgttgaagactgt
ttatcgtcgattatcattatttttcgttatgtcgaagacaaggatgtttttcaaaacttt
tatactaagcttttagccaagcgacttgtgaatggtacctctaattcccaggatgctgaa
tctagcatgctatctaagttaaaggaagtctgcggttttgaatatactagtaagctacag
cgtatgtttcaagacatctccttgtctcaagagattaccgaagcgttttggcaactccct
cagtcacgtgctggaaatatagatttctctgctcttgtacttggtacatcgttttggcct
ctatctcccaacaatgtgaactttcatctgccagaggaattagttcctttgtatgaagga
ttccaaaactattactatagctgccataacggaaggaagttaagctggttgttccatctc
tctaaaggagaaataaaggcacgcattaaccctcaaactaatgtcacttatgtgtttcaa
gtttctacatatcaaatgggtgttttgcttttgtacaaccatcgcgattcttatacatat
gaggagctggcaaaaataactgggttaagtacagatttcttgacagggattctgaacata
ttcctaaaagcaaaggtgcttctccttggcgacaatgacaagcttggtgatcctaatagc
acatataagatcaatgaaaattttaggatgaaaaagatacgggtacagttaaatctccca
attagatctgagcaaaagcaggaatctctggagactcataaaactatagaagaagatcga
aagttactgcttcaatccgctatcgtccgtatcatgaaggctcgccgaacattgaaacat
gtagtgttagtgaaagagactattgatcaaattaaaagcagatttactcctaaagtgtct
gatattaagcaatgtatagatatgttaatcgaaaaagagtacctggaacgccaaggccgc
gatgaatacatttaccttgcttga

DBGET integrated database retrieval system