KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17G8.13cHelp
Entry
SPAC17G8.13c      CDS       T00076                                 

Gene name
mst2
Definition
histone acetyltransferase Mst2
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SPAC17G8.13c (mst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(2365447..2366127,2366175..2366264,2366381..2366833))
Genome map
AA seq 407 aa AA seqDB search
MPATILKSTASSKTLLIIKFDTNSSRYPFYKKHLLELNSESTFLGLLTKGQADTSITRLN
QDDVRLFEKAKTVADRTKDVAYSFSDPILSTQLRTPPPQPTSIRYLYFGTYRIKPWYTSP
YPEEYSCAKNLYICESCLKYMNSDHVLQRHKMKCSWSYPPGDEIYRDKNISIFEVDGQRQ
PIYCQNLCLLAKMFLHSKMLYYDVEPFLFYVLTEFDGQECKVIGYFSKEKRSASDYNVSC
ILTLPIYQRRGYGVFLIDFSYLLTQVEGKLGSPEKPLSDLGLVTYRSYWKMRVAKALLEI
TTPISINAIAKSTSMVCDDVISTLESLSVFKYDPLKKKYVLQLKRDELENVYKAWNIKHP
QRVNPKLLRWTPYLGEEQISNLLLKENILIPLPQKRLLDNSHHLDSV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgactattttgaaatccacagccagttcaaagactttgttaataataaagttt
gatacaaactcctccagatatccattttataagaaacatttattagagttaaattcggaa
agtacttttttgggtctattaactaaagggcaagctgacacatcgattacgagactcaac
caagacgatgtgaggctgtttgaaaaagcaaagacagtagcagataggacaaaggatgtg
gcttattcattttccgatcctattttatctacacagttgcgaacgcctccaccacaacca
acctccattcgatacctctattttggtacttaccggataaaaccatggtatacatcaccg
tatccagaggagtatagctgtgcaaaaaatttatatatatgcgaatcttgtttaaagtat
atgaacagtgatcatgtactacaaaggcacaagatgaaatgctcatggagttatccacca
ggagatgaaatatatcgggataagaatatatcaatttttgaagttgatggtcaacggcaa
ccgatatattgtcaaaatttatgtcttctagcaaagatgtttcttcattcaaaaatgctg
tactatgacgttgaaccgtttcttttctatgtattgactgaatttgatggccaagaatgc
aaagttattggatatttcagtaaagagaaacgctcggcttctgattataacgtttcctgt
atattaacattacccatttaccaacgccgaggatatggtgtctttttgattgattttagt
tatttacttacacaggtagaaggtaagcttggatcacctgaaaagccactttcagattta
ggcctcgttacgtaccgaagctattggaaaatgagagtagccaaagctctattggaaatc
acaacaccgattagcataaatgctatcgccaaatcaacatctatggtatgcgacgatgtt
atatccacattggaatcgttatctgtatttaagtatgatccgctcaaaaagaaatatgta
ttacaactgaaacgggatgaacttgagaatgtttataaagcttggaatatcaaacaccct
caaagagtaaatccaaaacttctaagatggacgccatatctcggagaagagcagatatct
aaccttttacttaaagaaaatatacttattcctctacctcaaaagcgtctattagataac
tctcatcatctggattccgtttag

DBGET integrated database retrieval system