KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17H9.10cHelp
Entry
SPAC17H9.10c      CDS       T00076                                 

Gene name
ddb1
Definition
damaged DNA binding protein Ddb1
Orthology
K10610  
DNA damage-binding protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC17H9.10c (ddb1)
  Replication and repair
   03420 Nucleotide excision repair
    SPAC17H9.10c (ddb1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul4 complex
    adoptor protein
     SPAC17H9.10c (ddb1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      SPAC17H9.10c (ddb1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      SPAC17H9.10c (ddb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(2021224..2024442)
Genome map
AA seq 1072 aa AA seqDB search
MTYVTYLHKPSSIRNAVFCKFVNASSWNVIVAKVNCLEVYSYENNRLCLITSANIFAKIV
NVKAFKPVSSPTDHIIVATDSFRYFTLFWDANDNTVSNGIKIQDCSERSLRESQSGPLLL
VDPFQRVICLHVYQGLLTIIPIFKSKKRFMTSHNNPSLHDNFSVRIQELNVVDIAMLYNS
SRPSLAVLYKDSKSIVHLSTYKINVREQEIDEDDVVCHDIEEGKLIPSENGGVFVFGEMY
VYYISKDIQVSKLLLTYPITAFSPSISNDPETGLDSSIYIVADESGMLYKFKALFTDETV
SMELEKLGESSIASCLIALPDNHLFVGSHFNNSVLLQLPSITKNNHKLEILQNFVNIAPI
SDFIIDDDQTGSSIITCSGAYKDGTLRIIRNSINIENVALIEMEGIKDFFSVSFRANYDN
YIFLSLICETRAIIVSPEGVFSANHDLSCEESTIFVSTIYGNSQILQITTKEIRLFDGKK
LHSWISPMSITCGSSFADNVCVAVAGGLILFFEGITEVGRYQCDTEVSSLCFTEENVVYV
GLWSADIIMLTYCQDGISLTHSLKLTDIPRSIVYSQKYGDDGGTLYVSTNNGYVLMFNFQ
NGQVIEHSLRRNQLGVAPIILKHFDSKEKNAIFALGEKPQLMYYESDKLVITPLSCTEML
NISSYVNPSLGVNMLYCTNSYISLAKMSEIRSLNVQTVSVKGFPRRICSNSLFYFVLCMQ
LEESIGTQEQRLLSFLRVYEKNTLSEIAHHKFNEYEMVESIILMNDDKRVVVGTGFNFPD
QDAPDSGRLMVFEMTSDNNIEMQAEHKVQGSVNTLVLYKHLIVAGINASVCIFEYEHGTM
HVRNSIRTPTYTIDISVNQDEIIAADLMKSITVLQFIDDQLIEVARDYHPLWATSVEILS
ERKYFVTEADGNAVILLRDNVSPQLSDRKKLRWYKKFYLGELINKTRHCTFIEPQDKSLV
TPQLLCATVDGSLMIVGDAGMSNTPLLLQLQDNIRKVIPSFGGLSHKEWKEYRGENETSP
SDLIDGSLIESILGLREPILNEIVNGGHEGTKLDISVQDLKSIIENLEKLHP
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgttacttatttgcacaagccttcttctataagaaacgccgtgttttgtaaa
tttgtcaatgcatcctcctggaacgtaatagtggctaaagtaaattgtttggaagtctat
agctatgaaaataatcgattatgtttaataacttctgctaatatttttgcgaaaattgtg
aatgtaaaagcttttaagcctgtttcatccccgacagatcatataatcgttgcaacagat
tcctttcgttattttacacttttttgggatgccaatgataacactgtttctaatggaata
aagatacaggattgcagtgaaaggtctcttcgggaaagtcaatctggacctttgctgtta
gtggatccatttcaacgggttatttgtttacatgtatatcagggtttactgactattatc
ccaatttttaagtcaaaaaaacgatttatgacttctcataacaatccttcattgcatgat
aattttagtgtgcggattcaagagttaaatgttgtcgacatagccatgctttataactca
tcccgtccatctttagcagttctctacaaggatagcaagtcgattgtgcatctttctacg
tacaaaataaacgttcgtgaacaagaaatcgacgaggatgatgttgtttgtcatgacatt
gaggaaggtaaattgatacctagtgagaatggtggtgtttttgtgttcggggagatgtat
gtatactatataagtaaagatattcaggtttcgaaacttcttttaacatacccgatcact
gcgttctctccttccatttctaatgatcccgagactggcctcgattctagtatttatatt
gtagcggatgagtcgggtatgttgtacaagtttaaagctttgttcactgatgagactgtt
tcaatggaattggaaaaattaggtgagtcttcaattgcttcttgtctaatagcacttcct
gacaatcacttgtttgttggaagtcattttaataattctgttctactacaacttccatcc
atcaccaaaaataatcataagctcgaaatactacagaatttcgttaatattgcacccatt
agtgatttcattatagacgatgatcaaactggttcatcaataatcacttgcagtggggct
tataaagatggaactttaaggattataagaaatagcataaacattgaaaatgttgcttta
attgaaatggagggaattaaggattttttttccgtttcttttagggcaaattatgacaat
tatattttcttgagtttaatttgtgagacgcgtgcgattattgtttcacctgaaggagtt
ttttcagcaaatcatgatctgtcttgtgaagaatctaccatattcgtttcaactatatat
ggcaacagtcaaattttgcaaatcactaccaaagaaatacgcctatttgatggaaaaaaa
ctgcactcttggatatctccaatgtcaattacatgtggtagttcctttgcagataatgtc
tgtgttgctgttgccggtggtttgatactgttttttgagggcattactgaagttggtaga
taccagtgcgatactgaggtttcctctctttgttttacggaagaaaatgtcgtatacgtt
ggtctttggtcagcagatataataatgctgacatattgtcaagatgggatatctttaact
cattcccttaaactaactgacattcctcgtagcattgtttattcacagaaatacggtgat
gatggaggtaccctatatgtctctactaataacggttatgtccttatgtttaattttcaa
aatggacaggttatagaacattctctaaggcgtaatcaattgggcgttgcccctatcatt
cttaaacactttgattcaaaggaaaaaaatgctatatttgctttaggcgaaaaaccacag
ctcatgtattatgagtcagataaattggtaattacaccactttcttgtacggaaatgttg
aatatatcttcttatgtgaacccttccttaggagtaaatatgctttattgcactaatagt
tatatatctcttgctaaaatgagtgaaattcgaagcttaaatgttcaaactgtttctgtc
aaagggtttccgcggagaatttgttcaaattcgttgttttactttgtcttatgtatgcaa
ctagaagagtcgattggtacacaggagcaacgtttattgtctttcttgagagtttacgaa
aaaaacactttaagtgagattgctcatcataagtttaatgaatatgaaatggttgaaagt
atcattttaatgaatgatgataaacgtgtggttgtgggcacaggtttcaactttccagat
caagatgccccagattcaggccgtttaatggtctttgagatgacttccgataataatatc
gaaatgcaagctgaacataaggtccagggatctgtgaacactttagttctgtataaacat
ttgatagtcgccggcattaatgccagtgtctgtattttcgaatatgaacacggtactatg
cacgtaaggaattctattaggacacctacttatacgatcgacatttccgttaatcaggac
gaaatcatcgcagcagatttaatgaagtctattaccgttctacaatttattgatgatcaa
ctaatagaagttgccagagactatcatccattgtgggcaacatccgttgaaattttgtca
gaaagaaagtactttgtaactgaagcagatggcaacgcagtgattcttttgagagacaat
gtctctcctcaattgtccgatagaaaaaagttacgttggtacaaaaagttctatcttggt
gaattgataaataaaactaggcactgcacatttatagaaccacaggataaatcccttgtc
acaccacagttgttatgcgcaacagttgacggcagcctcatgattgtgggtgatgccgga
atgtctaatactcctttgttactacagctgcaggataacattagaaaagttataccttcg
tttggaggcttgagtcataaggaatggaaagagtatcgaggtgaaaatgagaccagtcca
tctgatttaattgatggctctttgattgagagcatccttggtttacgtgaacctatattg
aatgaaattgtaaatggtggtcatgagggtacaaagcttgatatttctgttcaagatcta
aaaagtattattgaaaatcttgagaaactacatccttaa

DBGET integrated database retrieval system