KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17H9.12cHelp
Entry
SPAC17H9.12c      CDS       T00076                                 

Definition
mitochondrial cytochrome c-heme linkage protein Cyc2 (predicted)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spo00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(2026163..2026963)
Genome map
AA seq 266 aa AA seqDB search
MSSSTYRKLPKILAAGLAIGCAGGYYAYKNSNKPPGLNPEIYAPFTVNKITELTSDASLF
SLVPQSPSEHLTTLEPIAKVTIRDPSMQVQRPYTPLYLDANELKFFIRKYEEGPVSSYIH
SKKEGDTIELRGPFKTTKLDCTKYPRIVAIVAGTGIAPIYQLAQSVKSPVDIVYCSRPGQ
PPLLKEELEKECPNVRVKSVQNRLVNIHDILDWDNVTVPLKDTLCIVCGSQKFVSTIAGP
KADYGARQGEVKGLLSNNPFGKVWKL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcgacttacaggaaattgcctaaaatcttagctgcaggtcttgctattggt
tgcgcaggtggttattatgcttataaaaattcgaataagcccccaggacttaatcccgaa
atttatgctccatttacagttaataaaattacagagcttacatccgatgctagcttgttt
tcgttagttcctcagagcccttctgaacaccttactactttggaaccgattgctaaggta
acaattcgtgatcccagtatgcaagtccagagaccatatacccctttgtacttggatgcc
aatgaattaaagttctttattagaaagtatgaagagggtcccgttagttcttatattcat
tctaagaaagaaggggacactattgaacttcggggtccttttaaaaccaccaaactcgat
tgtacgaagtacccaagaatcgtagctatcgttgcaggaacaggaattgctcctatatat
caattagctcagtctgttaaatccccagtcgatattgtatactgctcaaggcctggtcag
ccccctttgctaaaagaagaattggaaaaggaatgcccaaacgtaagggtgaagtccgtc
caaaatcgtttggtaaacattcatgacattttggattgggataatgttacagttccttta
aaggataccctttgcattgtctgcggtagccagaagtttgtttctacaattgccggaccg
aaggctgattatggcgcaagacaaggagaagtcaaaggacttttatcaaacaatccgttt
gggaaagtttggaagctttag

DBGET integrated database retrieval system