KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17H9.12cHelp
Entry
SPAC17H9.12c      CDS       T00076                                 

Definition
mitochondrial cytochrome c-heme linkage protein Cyc2 (predicted)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPAC17H9.12c
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SPAC17H9.12c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(2026163..2026963)
Genome map
AA seq 266 aa AA seqDB search
MSSSTYRKLPKILAAGLAIGCAGGYYAYKNSNKPPGLNPEIYAPFTVNKITELTSDASLF
SLVPQSPSEHLTTLEPIAKVTIRDPSMQVQRPYTPLYLDANELKFFIRKYEEGPVSSYIH
SKKEGDTIELRGPFKTTKLDCTKYPRIVAIVAGTGIAPIYQLAQSVKSPVDIVYCSRPGQ
PPLLKEELEKECPNVRVKSVQNRLVNIHDILDWDNVTVPLKDTLCIVCGSQKFVSTIAGP
KADYGARQGEVKGLLSNNPFGKVWKL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcgacttacaggaaattgcctaaaatcttagctgcaggtcttgctattggt
tgcgcaggtggttattatgcttataaaaattcgaataagcccccaggacttaatcccgaa
atttatgctccatttacagttaataaaattacagagcttacatccgatgctagcttgttt
tcgttagttcctcagagcccttctgaacaccttactactttggaaccgattgctaaggta
acaattcgtgatcccagtatgcaagtccagagaccatatacccctttgtacttggatgcc
aatgaattaaagttctttattagaaagtatgaagagggtcccgttagttcttatattcat
tctaagaaagaaggggacactattgaacttcggggtccttttaaaaccaccaaactcgat
tgtacgaagtacccaagaatcgtagctatcgttgcaggaacaggaattgctcctatatat
caattagctcagtctgttaaatccccagtcgatattgtatactgctcaaggcctggtcag
ccccctttgctaaaagaagaattggaaaaggaatgcccaaacgtaagggtgaagtccgtc
caaaatcgtttggtaaacattcatgacattttggattgggataatgttacagttccttta
aaggataccctttgcattgtctgcggtagccagaagtttgtttctacaattgccggaccg
aaggctgattatggcgcaagacaaggagaagtcaaaggacttttatcaaacaatccgttt
gggaaagtttggaagctttag

DBGET integrated database retrieval system