KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17H9.13cHelp
Entry
SPAC17H9.13c      CDS       T00076                                 

Definition
glutamate 5-kinase (predicted) (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPAC17H9.13c
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPAC17H9.13c
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPAC17H9.13c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(2027344..2028198,2028275..2028573,2028698..2028752))
Genome map
AA seq 402 aa AA seqDB search
MSPKSKSTNKTYTIVIKLGTSSICDEKTHEPLISNLSLIVETVVKLRKLGHNVVLVSSGG
IAMGLRRLDLPKRPSKLSAVQAIAAVGQGRLISLWDTLFTQLRQPIAQVLITRNDIAERS
QYVNAANTISELLHFGVVPIVNENDTLSVQEIRFGDNDTLSAITAGMINADYLFLLTDVD
CLYTDNPRTNPDAKPILKIHDTSMVNANVSTPGSGVGTGGMKTKLIAADLGTSSGVNVII
CRGSKPSSIFDIIRQESSDNKNESVELPLHTHFVAKKQGRIRDRHFWLLHGLKSHGSLEI
DRGAFEAITRTNRAGLLPVGVTKVHGHFSAHQAVTVIYNGEEIGRALVNYSSTEIDLIKG
KRSKEIASILGYNETEYVAYRDYLVVHGLNSHHDSQVSSDEH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgaagtcgaaaagcacaaataagacttacacaattgtcatcaaacttggcaca
tcgtcaatttgtgatgaaaagactcatgaaccattaatttcaaatttgtcactaatcgtt
gaaaccgttgtcaagcttcgaaagttgggtcataatgtcgttttggtttcaagtggtggt
attgcaatgggccttcgtagattagatttacctaagcgtccttcaaagctttctgctgta
caagcaattgccgcggtcggtcaaggaagactaatttccttatgggataccttatttaca
caacttcgtcagcctattgcgcaagttttaatcactagaaacgacattgccgagagatcc
caatatgtaaatgcagcgaacacaatttccgagttgctacattttggggtagttcccatt
gtaaatgaaaatgatactctgtctgttcaagaaatccgttttggtgataacgatacttta
tcggcaattacagctggcatgataaacgcagattatttgtttttacttacagatgttgat
tgtttgtatacagacaacccacgtaccaaccctgacgctaagcctattttaaaaattcat
gatacatcaatggtaaatgcaaacgtttccacacccggtagtggagttggaacaggggga
atgaagacgaaattgatcgctgcagatttgggaacgtcttcaggcgtaaatgttataata
tgtcgtggttctaaaccttcgagtatattcgatataatccgtcaggaatcctctgataat
aaaaatgagtcagttgaattacctctgcatacccactttgtagccaaaaagcaaggaagg
atccgtgatcgacacttttggcttttgcacggccttaaatcacatgggagtttggaaatt
gatcgtggggctttcgaggctataacccgtacaaatagagcaggattactaccagttggt
gtaaccaaagtacatggccatttttcagctcaccaagcagttacggttatttacaacgga
gaggaaattggcagagcccttgttaattacagcagtactgaaatagatttgattaaaggc
aagagaagcaaagaaattgcatccatcttaggatataacgaaactgaatatgtcgcctac
agagactatttagtagttcatggtttaaattctcatcatgattcacaagttagttctgat
gagcattga

DBGET integrated database retrieval system