KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17H9.14cHelp
Entry
SPAC17H9.14c      CDS       T00076                                 

Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:spo04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(2029229..2030308)
Genome map
AA seq 359 aa AA seqDB search
MRLPLLSFVIFALFALVFASGVVELQSLNELENTIRASKKGALIEFYATWCGHCKSLAPV
YEELGALFEDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDS
LTQFVSEKTGIKKRKIVLPSNVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTY
ETLGKVFKNEPNVEIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLES
LIEYINKKSGTQRSPDGTLLSTAGRIPTFDEFAAEFLDMSNAAKEVVLEKVKQLALEDSS
RWTKYYKKVFEKILNDENWVHKEAKRLSKLLRQKSIALASADDFKTRLNILNSFLPGNH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagattacctctgctgagttttgttatatttgcgctttttgcgcttgtatttgcatca
ggtgttgtagagctccaaagtctcaatgagttggagaatactatccgagcttctaaaaaa
ggagcattgattgagttttacgccacctggtgtggacattgtaaatctttagcgccagtg
tatgaagaacttggcgctcttttcgaagaccacaatgatgtcttgattggcaaaattgat
gcggatacacactccgatgttgctgataaataccacattactggttttccaacactgatc
tggtttcctcctgatggatctgaaccagttcagtactccaatgctcgcgacgttgacagt
ttgactcaatttgtgtctgagaaaactggtatcaaaaaacgcaagattgtcctccctagc
aatgtagttgagctcgattctttgaattttgacaaggttgttatggacgataaaaaagat
gttttagttgaattttatgcggattggtgcggttattgcaagcgtttggctcctacttac
gaaactcttggcaaggtattcaaaaacgaaccaaacgttgagattgttaaaattaatgca
gacgtctttgctgacatcggaaggctacatgaagttgcaagctttcccaccatcaaattc
tttcctaaagatgataaagataagcctgaattatacgaaggagatcgttctttagaatct
ttgatcgagtacattaataagaaatctggaactcaacgttctcccgatggcactttactt
tctactgccggccgtattccaactttcgatgaatttgctgctgagtttttggatatgtca
aacgctgccaaggaagttgttcttgaaaaagtcaagcagttagccttagaggattcatct
agatggactaagtattacaagaaggtttttgagaagattttaaatgatgaaaattgggta
cataaagaagctaagcgtttgtctaaacttttacgccagaagagcatcgctttggccagt
gctgatgattttaaaactcgccttaacattctaaattccttccttcctggtaatcactag

DBGET integrated database retrieval system