KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1805.06cHelp
Entry
SPAC1805.06c      CDS       T00076                                 

Gene name
hem2
Definition
porphobilinogen synthase Hem2 (predicted) (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC1805.06c (hem2)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SPAC1805.06c (hem2)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPAC1805.06c (hem2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(2783941..2784930)
Genome map
AA seq 329 aa AA seqDB search
MPVDISSLLHAGYSNPLLREWQGVRPITKSSLMYPIFISEIDDAKEAIDSMPNQFRWGVN
RLEEFLGPLVKKGLRSVILFGVIESKKDYCGSMADSENGPVIKAVKEIRHLFPELVVACD
VCLCEYTDHGHCGLLYEDGTINNAKSVERIAEVSGNYALAGAQIISPSDCMDGRVKAIKQ
KLVELELSHKVCVISYSAKFASGFFGPFRAAANGAPKFGDRSCYQLPCNARGLAKRAILR
DVREGADGIMVKPGTPYLDILAMASKLADDLPIATYQVSGEFAIIHAAAAAGVFELKRHV
METMDGFMRAGANIVLTYFTPELLEWLEY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgatatcagttctcttttgcatgctgggtattcaaacccgttgcttcgtgaa
tggcaaggtgtacgtcccattaccaagtcatctctaatgtatcctatcttcatttccgaa
atagatgatgctaaggaagccattgatagcatgcctaatcaatttagatggggtgttaat
agattggaagagtttttgggtcctctcgtcaaaaaaggtcttcgtagtgtaattctgttt
ggtgtcatcgagtccaaaaaggactattgtggtagcatggccgattccgaaaatggacca
gttattaaagccgttaaagaaattcgtcacctttttccggagctggttgttgcttgtgat
gtttgtctctgcgagtatactgatcacggccactgtggtctgttatatgaagatggcact
atcaataatgctaaatccgttgagagaattgctgaagttagtggaaattatgccttggca
ggcgctcaaataatttctcctagtgactgcatggacggtcgtgttaaggcgattaagcag
aaacttgtagagttggaactgtctcataaagtatgcgttatttcctattctgcaaagttc
gcttctggtttttttggtcctttcagagctgctgctaatggtgccccaaaatttggtgat
cgcagctgttatcaacttccctgtaatgcacgtggcttggccaaaagagcaattcttcgc
gatgttagagagggtgctgatggtattatggtaaaaccgggaacaccttatctcgatatt
ttggcaatggcttctaagctagcagatgaccttcctattgctacttatcaagtttcaggc
gaattcgccattattcatgctgctgctgccgctggcgtatttgaattaaaaagacatgtg
atggaaaccatggatggctttatgcgtgctggcgctaacatagttttgacttactttact
cctgaattattggaatggctagaatattaa

DBGET integrated database retrieval system