KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1805.15cHelp
Entry
SPAC1805.15c      CDS       T00076                                 

Gene name
pub2
Definition
(RefSeq) HECT-type ubiquitin-protein ligase Pub2
  KO
K10591  
E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
MAPK signaling pathway - yeast
Ubiquitin mediated proteolysis
Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC1805.15c (pub2)
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SPAC1805.15c (pub2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SPAC1805.15c (pub2)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     SPAC1805.15c (pub2)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  HECT type E3
   SPAC1805.15c (pub2)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    SPAC1805.15c (pub2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(2798023..2798122,2798164..2799766,2799862..2799995,2800053..2800231))
Genome map
AA seq 671 aa AA seqDB search
MENIRFEVQLTILHVEGLWKNGLLRSLKPYLLISVDDDQFIKTNVASGTLRLSWGFTQKL
TVSPQSIILLQLFDEKQKNETSDGFVGLGAAVVNSFLPFNNPKDDYKTRITLRSPSGSYR
GSVVCLFKRSKFLPEELPADKSQICTDIIDDASGCAWETRIDEFGHVYYLKSPQLSVISA
ISHEKLENLTPKQLKEVFSQFLFNNQSKSSLKINLEYKVIKHLLEHYPLALSVRQQVAVE
KGPLPAGWEMRLSEDYHVYFVDHSTKTTTWSDPRDNVVASDSVSENTDSIQQINDEYQRK
IAYMYDRPEMAVNDAQLQLKVSRATTFEDAYDIISKLSVSDMKKKLLIRFRNEDGLDYGG
VSREFFYILSHAIFNPGYSLFEYATDDNYGLQISPLSSVNPDFRSYFRFVGRVMGLAIYH
RRYLDVQFVLPFYKRILQKPLCLEDVKDVDEVYYESLKWIKNNDVDESLCLNFSVEENRF
GESVTVDLIPNGRNIAVNNQNKMNYLKALTEHKLVTSTEEQFNALKGGLNELIPDSVLQI
FNENELDTLLNGKRDIDVQDWKRFTDYRSYTETDDIVIWFWELLSEWSPEKKAKLLQFAT
GTSRLPLSGFKDMHGSDGPRKFTIEKVGHISQLPKAHTCFNRLDIPPYNSKEELEQKLTI
AIQETAGFGTE
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatattcgctttgaagtccaattgacaatccttcacgtggaaggattatggaag
aatgggcttttacgatctttaaagccttacctgcttattagtgtcgatgatgaccagttt
atcaagacgaatgttgctagtggcacacttcgtctttcatggggctttactcaaaaatta
actgtgtctcctcaaagcataatacttttacaattgttcgacgaaaaacaaaaaaatgaa
acatctgatggatttgtcggtttgggggcagcagtggtaaattcgttcctgccttttaat
aacccaaaggatgactacaaaacacgtattactttaagatctccatcaggatcttatcga
ggctccgtagtttgtttatttaaacggtctaagtttttaccagaagaacttcctgctgat
aaatcgcaaatttgtaccgacattattgatgatgctagtggatgcgcttgggaaacaaga
attgatgagtttgggcatgtttattatttaaaatctcctcagctatcggtgatatcagcc
atttctcatgagaagcttgaaaatttgactcctaaacagctgaaagaagttttttctcag
tttctttttaataatcaatcgaaatcttctttaaaaattaatctggaatacaaagtaatc
aaacatttattggaacactaccctttggctttgtctgttcgccagcaagtggccgtcgaa
aagggaccgcttccagccgggtgggagatgcgtttaagtgaagactatcatgtttatttt
gtggatcattctactaaaacgactacatggagtgatcccagagataatgttgtggcttct
gacagcgtgtctgaaaatacagattcaatccaacaaatcaacgatgaatatcaaagaaaa
atcgcttacatgtatgaccggcctgaaatggccgttaatgatgctcaacttcagctaaag
gttagcagagccactacatttgaagacgcgtacgatataatatcaaagttatccgttagc
gatatgaaaaagaagctcctaattcgattccgtaatgaagacggtttggattatggaggg
gtttctagggagttcttttatattttgtctcatgcaatattcaatcctgggtattccttg
tttgaatatgctacagacgataactatggtcttcaaattagccccttatcttctgtgaat
ccagattttcgttcctactttcggtttgttggcagagttatgggattggctatatatcat
cgtcgatatttggatgttcaatttgtattacctttttataaacggatcctccaaaagcca
ttgtgcctcgaggacgtaaaggatgttgatgaagtttattatgaaagcttgaaatggatt
aagaacaatgatgttgatgaatctctgtgcctaaactttagcgttgaggaaaaccgattt
ggtgaatctgtgacggtcgatttaattccaaatggccgtaatattgcagtcaataatcag
aataaaatgaattatcttaaagctcttacggagcataaacttgtcaccagtactgaagag
caatttaatgctttgaaaggtggattgaatgaattaatacctgattcggttttgcaaata
tttaatgaaaacgaacttgatacattacttaacggaaaaagggatatcgacgttcaagat
tggaagcgttttacagactataggtcttatactgagactgatgacattgtaatttggttt
tgggagctactgagtgagtggtctccggaaaaaaaggcgaagcttctgcaatttgctact
ggtacctccaggcttcctttatccgggttcaaggacatgcatggtagtgatggcccacga
aagtttacaatcgagaaagtagggcatatctctcagcttccaaaagctcatacttgcttc
aatcgtttagatattccgccttataattccaaagaagaactagaacaaaaactcacaatt
gctattcaagaaactgcaggatttggtacggagtaa

DBGET integrated database retrieval system