KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1834.11cHelp
Entry
SPAC1834.11c      CDS       T00076                                 

Gene name
sec18
Definition
(RefSeq) secretory pathway protein Sec18 (predicted)
  KO
K06027  
vesicle-fusing ATPase [EC:3.6.4.6]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.6  vesicle-fusing ATPase
     SPAC1834.11c (sec18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(4718738..4721116)
Genome map
AA seq 792 aa AA seqDB search
MDSRWKLPFMSNKGTPEQPMRKPLSGSYSHNSAGPTPNMSPFEQKPPLPTHMDVRRPSGP
FRIVKATSTEDALTNCIIVSPMDFKQQYIIVDNSRVFSTKPVPGFPQGCLGASQPHREWA
SWSLNQQVHVADYDPYGPHGAPYLHSMTLEVDFQNRNRTTNEPFDGEEMAKLFCSSYQSQ
VFSPGQKIVFDFRSYNIKATVRTISCVDLLIGENQDAENTADTSKRGLLTSQTEIQFFKA
AHSALRLKASMTRPASNAILQPGFKFEDMGIGGLDSEFSAIFRRAFASRLFPPGMVEKLG
INHVKGILLYGPPGTGKTLIARQIGKMLNAREPKIVNGPEILNKYVGQSEENVRKLFADA
EREYRDRGEESGLHIIIFDELDAICKKRGSSGGDTGVGDQVVNQLLAKMDGVDQLNNILV
IGMTNRKDMIDEALLRPGRLEVHMEISLPDEHGRLQILKIHTSRMASNGILENDVDMEEL
ASLTKNFSGAEIAGLIKSASSFAFYRHIKVGTTAAVSGNLENIKVNRNDFLNALSEVRPA
YGVSEEELESRVQGGIINFGKHIEEIITEGKLFVQQVKNSERTRLVSVLLSGPIASGKTA
LAATIALGSEFPFVKLVSAESMVGMNENARVAHVNRVFEDSYKSPLSVIVVDEIERIIDW
VPIGPRFSNTLLQTLMVLFKKQPPKGHRLLILATTSERTMLSRMDMTQSFDAEIAVPNVS
NVTELDRIIQSIDSFADSNVRADTLQRLQNFTGTDAVNVGVAKILMIAETAKQDVDVVSC
FVEAMARAIPME
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggactcaagatggaaacttccattcatgtccaataaagggacaccagagcaacctatg
aggaaaccactaagtggcagttattcccataacagtgctggtcctacacccaatatgagc
ccctttgagcaaaaaccaccgctgcctacacatatggatgttagacgcccttcaggtcct
tttcggatcgtcaaggcgacttctaccgaagatgctttaaccaattgtatcattgtttct
cccatggactttaagcagcagtacattattgtagacaactctcgtgtgttcagcactaaa
cccgttcctggctttccacagggttgtcttggcgcttcccagccccatcgcgaatgggct
tcttggtcgctaaatcagcaggttcatgttgccgactatgatccatatggtcctcatgga
gctccttatcttcatagtatgactttggaggtagactttcaaaatagaaatcgcaccact
aatgagcctttcgacggtgaagagatggccaagttattttgctctagttatcagagccaa
gttttttctccgggccagaaaattgttttcgatttccgttcttacaatataaaggcaacc
gtccgtactatatcttgtgtcgatcttttaattggtgagaatcaagatgccgaaaatact
gcagataccagcaaacgtggtctcttgacttcccagaccgaaatccaattttttaaagcc
gctcactctgcgttgcgtttgaaagctagcatgacaagacctgcctctaatgccattctt
cagccaggctttaaatttgaggacatgggcattggtggtcttgactcagagttcagtgct
attttccgtcgagcatttgcctctcgtctctttcctcctggcatggttgaaaagctgggt
attaatcatgttaagggtattctcttatatggccctccaggtactggtaagacattaatt
gctcgacaaattggtaaaatgctaaatgcccgtgaaccgaaaatcgttaatggtcctgaa
attctaaacaaatacgtcggtcaaagtgaagaaaacgttcgtaaattattcgccgatgct
gaacgtgagtatcgcgatcgcggagaggaatcgggtcttcatattattatcttcgatgaa
ttagatgccatatgtaaaaagagaggaagttctggtggtgatacaggtgttggcgatcag
gtcgttaatcagcttttggctaagatggatggcgttgatcaactgaataatatccttgtt
attggtatgactaacagaaaagacatgatcgatgaagctcttttgcgtccaggtcgtctt
gaggttcatatggaaatttcacttccagatgaacacggccgtttgcagattctgaaaatc
catacgtcccgtatggcttcaaatggtattttagagaatgatgttgacatggaagagcta
gcatctcttactaaaaacttttctggtgctgaaattgctggattaatcaagagtgcttca
agttttgctttttatcgccacatcaaggtgggaaccactgccgctgtttcaggtaatttg
gaaaatatcaaggtgaatcgtaacgactttttgaatgctttaagtgaggtaagaccagct
tatggtgtgagtgaggaggaactcgaaagccgtgtgcaaggtggcattatcaattttggt
aaacacattgaagaaataattaccgaaggaaaattatttgttcaacaagttaaaaactcc
gaacgtacacgtttggtcagtgtattattgtcaggccctatagcgtcagggaaaactgca
ttggctgccacgatagcccttggttctgaatttccatttgttaagctcgtttccgctgag
tccatggtaggaatgaatgaaaacgctcgagtagctcatgtcaatcgtgtgttcgaagac
agctacaaaagtcctcttagcgtcattgtagtagatgagattgaacgtattattgattgg
gtaccaatcggacctcgattttctaacaccttacttcaaacacttatggttcttttcaaa
aagcaaccccccaagggtcatcgattgcttattttagcaactacctctgaacgtactatg
ctctctcgaatggatatgacccaatcgtttgatgcagaaatagcagttcctaatgtctcc
aacgttactgaactggaccgcatcatacaatcaatagattcatttgcagacagcaatgtt
cgagctgatacattacaacgtttgcagaactttactggtactgatgctgtcaatgtcgga
gtagccaagattcttatgatagccgaaacggctaaacaggatgtagacgttgtttcctgt
tttgttgaagccatggcccgtgctattcctatggaatag

DBGET integrated database retrieval system