KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1952.05Help
Entry
SPAC1952.05       CDS       T00076                                 

Gene name
gcn5, kat2
Definition
(RefSeq) SAGA complex histone acetyltransferase catalytic subunit Gcn5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SPAC1952.05 (gcn5)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SPAC1952.05 (gcn5)
Chromosome [BR:spo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    SPAC1952.05 (gcn5)
   HAT complexes
    PCAF complex
     SPAC1952.05 (gcn5)
    STAGA complex
     SPAC1952.05 (gcn5)
    TFTC complex
     SPAC1952.05 (gcn5)
    SAGA complex
     SPAC1952.05 (gcn5)
    SLIK complex
     SPAC1952.05 (gcn5)
    ADA-HAT complex
     SPAC1952.05 (gcn5)
    HAT-A2 complex
     SPAC1952.05 (gcn5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PomBase: 
UniProt: 
Position
I:4974116..4975480
Genome map
AA seq 454 aa AA seqDB search
MSNSLNDQTRPPDSSVVDSTSSNFPNASNDSVHDKPVKQDEQSNPNVREAIANSDGQESL
AVKENKDTESSSSHFVPNGVSNSKKRKLVATDLDVDFDISSVRVTEKPSVLEEKSGVIQF
RVVSNDDTADSMIMLTGLKNIFMKQLPKMPKEYITRLIYDRNHLSMTIVKDNLHVVGGIT
YRPFEQRGFAEIVFCAIASNEQVRGYGSHLMNHLKDYVRGTTTIQHFLTYADNYAIGYFK
KQGFTKEITLDKSIWVGYIKDYEGGTLMQCTMIPKIKYLEANLILAIQKAAVVSKINRIT
RSNVVYPGLDVFKDGPAHIEPSQVPGLMEVGWCKEMEELSKKPRPKPFFAVLEMLFTEMQ
NHPSSWPFMQPVSKEDVPDYYEVIEHPMDLSTMEFRLRNNQYESVEEFIRDAKYIFDNCR
SYNDSNTTYYKNADRLEKFFQKKLRETEYSHLAD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattcgttaaatgatcaaacacgaccacccgattcaagtgttgtagacagtaca
tcttccaactttccaaatgcgtcaaacgatagtgtacatgataaaccggtaaaacaggac
gaacaatccaatccaaatgttcgcgaagcaattgctaattccgatggacaagaatcttta
gctgtaaaggaaaacaaggatacggaaagctcatcctctcatttcgtacctaacggagtt
tcaaattctaaaaagagaaagctcgtggctacagatttagatgttgattttgatattagt
agtgtacgagttactgaaaagccatctgtattagaagaaaaaagcggcgttattcaattt
cgtgttgtttctaacgacgacaccgccgacagtatgatcatgttgactggtttaaaaaac
atatttatgaaacaacttcctaaaatgccaaaagaatacattacgcggctaatttatgat
cgaaaccatctttcaatgaccattgtcaaagataatttacatgtagtgggcggtattact
tatcgtccatttgaacaacgaggatttgccgaaattgtattttgtgcgattgcttccaat
gaacaggttcgtggttatggttctcatttaatgaatcatttaaaggattatgtccgtgga
actactacaattcagcacttcttgacatatgcagataactatgcaatcgggtattttaaa
aaacaaggatttactaaggaaattactcttgacaagtctatatgggttggctatattaag
gattacgaaggtggcacacttatgcaatgcaccatgattccaaaaataaagtatttagaa
gctaatctgattttggctattcagaaagctgctgttgtttccaaaattaacaggatcact
cggtcgaacgttgtttatcctggtttagacgtattcaaagatggtccagctcatatagag
ccgtctcaagttcctgggttgatggaagttggatggtgcaaggaaatggaagagctctcc
aaaaagcccagacctaaacctttttttgccgttttggaaatgctttttacagaaatgcaa
aatcatccgtcttcctggccctttatgcaaccggttagtaaagaggatgtacccgattat
tacgaagttattgaacaccccatggacctttcgactatggaatttcggttgcgtaacaac
cagtatgagtctgtagaggaatttattcgggatgcaaaatatatatttgataattgccgt
tcttacaatgactccaacacgacttactataaaaatgccgatagattggaaaagtttttc
cagaaaaaacttcgtgaaactgagtattcacacttagccgattaa

DBGET integrated database retrieval system