KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1952.05Help
Entry
SPAC1952.05       CDS       T00076                                 

Gene name
gcn5, kat2
Definition
SAGA complex histone acetyltransferase catalytic subunit Gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SPAC1952.05 (gcn5)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SPAC1952.05 (gcn5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:4974116..4975480
Genome map
AA seq 454 aa AA seqDB search
MSNSLNDQTRPPDSSVVDSTSSNFPNASNDSVHDKPVKQDEQSNPNVREAIANSDGQESL
AVKENKDTESSSSHFVPNGVSNSKKRKLVATDLDVDFDISSVRVTEKPSVLEEKSGVIQF
RVVSNDDTADSMIMLTGLKNIFMKQLPKMPKEYITRLIYDRNHLSMTIVKDNLHVVGGIT
YRPFEQRGFAEIVFCAIASNEQVRGYGSHLMNHLKDYVRGTTTIQHFLTYADNYAIGYFK
KQGFTKEITLDKSIWVGYIKDYEGGTLMQCTMIPKIKYLEANLILAIQKAAVVSKINRIT
RSNVVYPGLDVFKDGPAHIEPSQVPGLMEVGWCKEMEELSKKPRPKPFFAVLEMLFTEMQ
NHPSSWPFMQPVSKEDVPDYYEVIEHPMDLSTMEFRLRNNQYESVEEFIRDAKYIFDNCR
SYNDSNTTYYKNADRLEKFFQKKLRETEYSHLAD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattcgttaaatgatcaaacacgaccacccgattcaagtgttgtagacagtaca
tcttccaactttccaaatgcgtcaaacgatagtgtacatgataaaccggtaaaacaggac
gaacaatccaatccaaatgttcgcgaagcaattgctaattccgatggacaagaatcttta
gctgtaaaggaaaacaaggatacggaaagctcatcctctcatttcgtacctaacggagtt
tcaaattctaaaaagagaaagctcgtggctacagatttagatgttgattttgatattagt
agtgtacgagttactgaaaagccatctgtattagaagaaaaaagcggcgttattcaattt
cgtgttgtttctaacgacgacaccgccgacagtatgatcatgttgactggtttaaaaaac
atatttatgaaacaacttcctaaaatgccaaaagaatacattacgcggctaatttatgat
cgaaaccatctttcaatgaccattgtcaaagataatttacatgtagtgggcggtattact
tatcgtccatttgaacaacgaggatttgccgaaattgtattttgtgcgattgcttccaat
gaacaggttcgtggttatggttctcatttaatgaatcatttaaaggattatgtccgtgga
actactacaattcagcacttcttgacatatgcagataactatgcaatcgggtattttaaa
aaacaaggatttactaaggaaattactcttgacaagtctatatgggttggctatattaag
gattacgaaggtggcacacttatgcaatgcaccatgattccaaaaataaagtatttagaa
gctaatctgattttggctattcagaaagctgctgttgtttccaaaattaacaggatcact
cggtcgaacgttgtttatcctggtttagacgtattcaaagatggtccagctcatatagag
ccgtctcaagttcctgggttgatggaagttggatggtgcaaggaaatggaagagctctcc
aaaaagcccagacctaaacctttttttgccgttttggaaatgctttttacagaaatgcaa
aatcatccgtcttcctggccctttatgcaaccggttagtaaagaggatgtacccgattat
tacgaagttattgaacaccccatggacctttcgactatggaatttcggttgcgtaacaac
cagtatgagtctgtagaggaatttattcgggatgcaaaatatatatttgataattgccgt
tcttacaatgactccaacacgacttactataaaaatgccgatagattggaaaagtttttc
cagaaaaaacttcgtgaaactgagtattcacacttagccgattaa

DBGET integrated database retrieval system