KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19A8.15Help
Entry
SPAC19A8.15       CDS       T00076                                 

Gene name
trp2
Definition
(RefSeq) tryptophan synthase (predicted)
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00260  Glycine, serine and threonine metabolism
spo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01130  Biosynthesis of antibiotics
spo01230  Biosynthesis of amino acids
Module
spo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAC19A8.15 (trp2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPAC19A8.15 (trp2)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPAC19A8.15 (trp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 2542240
NCBI-ProteinID: NP_593777
PomBase: SPAC19A8.15
UniProt: O13831
Position
I:complement(2457658..2459751)
Genome map
AA seq 697 aa AA seqDB search
MTEQIKKTFLKAKEENKNVLVTFVTCGFPNVDETIKIMQGLQNGGAGIIELGIPFSDAVA
DGPTICKGNEIALKNNITLEKVFETVKLARDAGVTIPIILMGYYNPIFSYGDAKTIQKAK
EVGANGFIIVDLPPEEAVGFREECKKQGVSFVPLVAPSTTDRRMELLASVADSFIYVVSR
MGSTGSSATGVINTALPQLCQRVRKFAGDTPLAVGFGVNTSEHFHQVGSVSDGVVVGSKI
IDLILKAEPGTAATVVEEYCKYLTKEDPSAPVPKQFQSGGSVATAPPAAVVEPINEMYLP
QKYGMFGGMYVPEALTQCLVELESVFYKALHDEKFWEEFRSYYEYMGRPSALDYAKRLTE
YCGGAHIWLKREDLNHGGSHKINNCIGQILLAKRLGKNRIIAETGAGQHGVATAICAAKF
GMKCTIYMGAEDCRRQALNVFRIRLLGAEVVPVTSGTQTLRDAVNEALKAWVEQIDTTHY
LIGSAIGPHPFPTIVKTFQSVIGEETKAQMQEKRKKLPDAVVACVGGGSNSIGMFSPFKA
DKSVMMLGCEAGGDGVDTPKHSATLTMGKVGVFHGVRTYVLQREDGQIQDTHSISAGLDY
PGVGPELSELKYTNRAEFIAVTDAQCLEGFRALCHLEGIIPALESSHAVYGGMELAKKLP
KDKDIVITISGRGDKDVQSVAEQLPILGPKIGWDLRF
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcagattaaaaaaacgtttctcaaagcaaaagaagaaaacaaaaatgtttta
gtgacatttgtcacttgcggttttcctaatgttgatgaaactatcaaaattatgcaaggt
ttgcaaaatggaggagcaggaataattgagcttggtattcctttttctgatgccgtcgct
gatggtcctacaatttgcaagggaaacgaaattgctttgaagaataatattactttagaa
aaagtatttgaaactgtaaagctcgctcgtgatgcaggtgtaactatccctataattttg
atgggttactacaatcctattttcagttatggagatgccaaaactattcaaaaggcaaag
gaggttggcgctaatggtttcatcatcgttgaccttcctccagaggaggctgtcggcttt
agagaagaatgtaaaaagcaaggtgttagtttcgttcctcttgttgctccttctactacg
gacaggcgtatggagctcttggcctctgtggctgactcctttatttacgttgtttctcgt
atgggtagtacaggatcatctgctaccggagtaatcaatactgctttgcctcagctctgt
cagcgtgttcgtaaatttgctggagatacccctctagcagttggttttggtgttaacacc
agtgaacatttccaccaagttggcagcgtgtcagatggtgttgtagttggaagcaaaatt
atcgatttgattttgaaggcagagcctggcactgctgctaccgtggttgaggaatattgt
aaatatcttactaaagaagacccatccgcacctgtacctaaacagtttcaatccggtggt
tctgttgctactgccccccctgctgctgtggtcgaacctatcaacgaaatgtatcttcct
caaaaatatggcatgtttggtggtatgtatgttccagaagcattaacccagtgcttagtt
gaacttgaaagtgtattttataaggctttgcatgatgaaaagttttgggaagaatttcgt
tcttattatgagtatatgggtcgtccaagtgccctcgattatgctaagcgtttaactgag
tattgtggtggtgcccatatttggttgaagcgtgaagacttgaatcatggtggttcacac
aaaattaacaactgtattgggcaaattcttcttgccaaacgtttaggaaaaaaccgtatc
attgctgaaactggtgctggtcagcatggagttgctactgctatctgtgccgctaaattt
ggtatgaaatgtactatctacatgggtgcagaagattgtcgtcgtcaagcactcaacgtt
tttcgcatccgtcttttgggagctgaagtcgttccggttacttcaggtacacagaccctt
cgtgatgctgttaacgaagctttgaaggcgtgggtcgaacaaatagacaccactcattat
ttaattggatctgcaattggccctcatccattccctaccattgttaaaactttccaaagt
gtcattggcgaggaaacgaaagcgcaaatgcaagagaagcgtaaaaaacttcctgatgca
gttgttgcttgtgttggtggtggatccaattcgattggaatgttttctcccttcaaagcc
gataaaagtgtaatgatgttgggttgtgaagctggtggtgatggtgtagatacccccaaa
catagtgctacattgactatgggaaaagttggtgtatttcatggagttcgaacatatgtt
ctgcaacgcgaagatggacaaattcaagatactcactctatatctgctggattggattat
ccaggtgtgggacccgaattatctgaacttaaatataccaatcgcgcagagtttatcgct
gtcactgatgctcaatgtttagaaggattccgcgctctatgtcatcttgaaggtatcatt
cccgctttggaatcttctcatgctgtgtatggtggaatggagcttgctaaaaagttacct
aaagataaggatattgtgatcaccatttcaggtcgtggtgacaaggatgttcaaagcgta
gctgaacaacttcctattttaggtcctaaaattggatgggaccttcgcttttaa

DBGET integrated database retrieval system