KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19B12.10Help
Entry
SPAC19B12.10      CDS       T00076                                 

Gene name
sst2
Definition
AMSH-like protease
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SPAC19B12.10 (sst2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPAC19B12.10 (sst2)
Peptidases [BR:spo01002]
 Metallo Peptidases
  Family M67
   SPAC19B12.10 (sst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(4901671..4901802,4901867..4902001,4902133..4903001,4903046..4903217)
Genome map
AA seq 435 aa AA seqDB search
MNILQGSEAPLSYEEIASRAGAFDFNKNIPLKNWLRTSTTISKQAHVYVSEHDYSNGVFL
LFRYCELFMKCQKHPDAAAYKKELFDYYQGVRNALEEIELIKPIVKEQYEQYQCQKNDLD
DLKKLSMKDSQPSLEKPVSYVDEPILEQWALSDLQILPPSSTDLLSPDSQKLSKSSSDLP
QFDYPSLNSSPTFNSNLPISSSRFEKTSLSDSKLVSPEPLDDNKDIQFIKKPIYTRTSEP
RPKPAGTFKIHAYTEGGKPLRTIYLPKLLKKVFLDVVKPNTKKNLETCGILCGKLRQNAF
FITHLVIPLQEATSDTCGTTDEASLFEFQDKHNLLTLGWIHTHPTQTCFMSSVDLHTHCS
YQLMLPEAIAIVMAPSKNTSGIFRLLDPEGLQTIVKCRKPGLFHPHEGKVYTMVAQPGHV
REINSKLQVVDLRVK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctccaaggatctgaagcaccattatcttatgaagagattgcttcaagagcc
ggagcattcgattttaataaaaatatccctttaaaaaattggttacgaacatccacgaca
atatcaaagcaagcccatgtttatgtatcggaacatgattattccaacggtgtatttctt
ttgtttcgctattgtgaattgttcatgaaatgccaaaagcaccctgatgctgcagcatat
aagaaagagctttttgattattatcagggtgtccgcaacgcgttagaggaaattgaatta
atcaaaccaattgtaaaggagcaatatgagcaatatcaatgtcagaagaatgatttggat
gatttaaaaaagttgtcgatgaaagattctcagccatctttggagaagcctgtttcttat
gtcgatgaacctattcttgagcaatgggcattatccgatttacaaattctccctccctcc
tcaactgatttactttcccccgattcccagaaattaagcaaatcttcatcagatcttcct
cagtttgattacccatctttaaattcatctcctactttcaattctaatttacctatatcc
agctctcgtttcgagaaaacatctttatctgactcaaaattggtctctcctgaaccgtta
gacgataataaagacattcagtttataaaaaagccaatatatacacgaacttccgaaccg
cgtcccaaaccagcaggaacttttaaaattcatgcatatacagaaggtggaaagccgttg
agaactatatatttaccgaaattattaaagaaggtttttcttgacgttgttaagcccaat
actaaaaaaaatcttgaaacatgtggaattttatgtggaaagctaagacagaatgccttt
ttcattactcatctcgttataccccttcaagaagctactagtgacacttgtggaacaacg
gatgaggcatctttatttgaatttcaggataagcataatctcttaactcttggatggatt
catactcatccgacccagacgtgctttatgagtagcgtggatttgcatactcattgttca
taccagcttatgctacctgaagctattgcaattgttatggctccttccaaaaatacctct
ggcatcttccgtttattagatcctgagggactacaaactatagtcaagtgtcgaaaacct
gggctttttcatccacatgagggaaaagtttatacgatggttgctcagcctgggcatgtt
agagaaattaactcgaaacttcaagttgttgatttgagggttaaatag

DBGET integrated database retrieval system