KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19D5.04Help
Entry
SPAC19D5.04       CDS       T00076                                 

Gene name
ptr1
Definition
E3 ubiquitin-protein ligase
Orthology
K10592  
E3 ubiquitin-protein ligase HUWE1 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC19D5.04 (ptr1)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPAC19D5.04 (ptr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:5208776..5218459
Genome map
AA seq 3227 aa AA seqDB search
MRITKSPPKNQYSQPPPRVAEFIRQAQNEEVTSDLGLVSLCSEFRKNDWPYPRGDLYSWV
PVLNRFDAILERIVEHYSLKDKVQTKPFDSDTLSILLEILSFSAHLLSHCANRSIYNSTV
YLEYLLNSSVLEVIDSTLALLLHIVQKATISKRGKQLFSLSQDRLFRFLMFLPQDAMKTG
FSQNYETLLFSNEIPQEWCSLELSYYKSSPSKDFSSASQPNSEGFSILKLPYNKVLGKPI
EELLVKTLHDNQIPEQYSFDLLVSLMLRQNLYDINRRRLMIRIGLLALSNLVYAHSQAVQ
TRFLIADPEITTHLANLVSPDVDLPQNFKAVCFECFKAFFFKKSMIPSVLASLNVSVSYG
LMMNLVRDFSKNLENPNFYYEREYVDSFYDFLQFMTSSPLGGNMACSAGLTSLLGYHLSV
KTPQATYVVARSIVMLDHLIDGYSMAFPDFSESKGLDMLVDRVQYELEAGLQDIKSGKGN
PEIVLNMDYAISYDRYFLLKNLLKFVLHLIQSGGSVVELRNLIDSSLISSLAFLLEHHEV
YGSNLFASTTNIMSTFIHNEPTCYGIIHEKKLSHAFLDAVNRKILNSSDAITSIPLAFGA
ICLNSQGFDLFLEKNPIPQLFSIFTSLNHCKSLISSDNAAILGTYIDELMRHQPSLKDPI
VKMIFKACDQVSALLDNFNPFQYINAKEYPYLLYLETFSSFLENIITNEGHARYLISKGI
VSHVLNLIQHPVLAFGFIDSSAFNSFFVLLHHAVDFDAPEVFRPLLDCIITRCEEGITEF
TIVSLKQATISLIKDSNMGHEDANNFLHFSIVGNLLTIFAELFSSHAALKKAGNLPLVQL
FISPSRYAGIFDILCNIKSIATSLDIHICLGVSDDFVLCSDSLTTIVTDKDEKEKFETKK
KELTQDSSFCKFQNIRSNFSQIAYGVSKFFTSLTRALGNTSVQDFNEYKMIHKLGSNIAL
VVDELINLSSKQITSHPQSLSIASLEASLIFVLGASSIIREDDSKVTLVLLISRLLGGCR
TMDVLISLNETVSGFFRLSDRDPLSKSNRVLLALSSTLLNLILVFTSADFMSETSKTLNM
ALKSEFDMTDFNNSGSKLMHVLHARIFISVLHLWRSADDLHLPYITRALLTNVLSNCYQF
EDGIKNVVDSINNLRTSIANGDIKEPLDVVTDDNTNSNFSLEETNASVTDMPESEKHENG
IFQAYLLKEMPNDIVSQFEMLKSKQIELTVQMASYEGDLNQNLCDFLYTRDDVQMNADVQ
FSVTSGLIVEIKKLAQSTDCKAKNQLGPAVGLLSLFISHDFTQNKAKNCVLSELNFFLEL
LHSLNNGLPSDSHKTSIVCILYLLEVLLADSKKPDEFEFNSEDCSLKLTDGAITVDLASQ
KHIMSSVITLLSLNSANLGVVVSAFRVVVLLTSASEMIHTFVKLSGLPSLFKAMRACSGF
CNESLHIPFISILRRLLEFDEVVELMMFDDLVNIFKLQGRARKTELHGFIRANAEMVLRS
PECFIKILKDCCVLGHFTPESEHYYLELKESLPGVLQNGQTDLDPSKEQMSSVIVSFLLD
ELMDLTETRQFSDRSPNSEFTPENDSLYMYNVFLLQCLTELLSGYNACKRCFLNFQPRRK
APFFNLSRKYNSYLVGFFLEKLLPFGCIRLSENNEVRKAFSVSNWAISILVFLCAYSNEQ
QTQAVDEIRREVLTSVLKFYKSSSSFSENLEAYYCKLLVLAELCYRLCDAQTVSQKAPNH
LLRRSQDQNVKTMIDLGYIPTLTNAISEIDMNYPVSRKVVRHILKPLQLLTKEAIFLSQT
NPEALSGAAQDSMGDQSLSSSSEESSDSDREEPPDLYRNSVLGIFQGDIVNENDENYEDS
EDDGVYEEMEFEDDQSGSADSVVSEDDADDVMYSDNDDMNIEFMVDEQDASSQNDDSSFD
EASSHGDVISIDEEDLDNQGEEFEWEDEDNASSGYEDELDYNEDEVGENDSTTFEAMENA
FTETSDNDDHLEEADHVSPVEIDFLENDENSSSEQDDEFQWEWNTETPSGADILSRHGAL
LRDLFPLPGLSRRVMIINSNDPSRSRPFLNNNASEGLLKHPLLLRNNLIHTPKATELWEN
LAEIDNHTASGAAFQRLLYYLALEIPNEDSSVLGWTSLKVSKHTDPLRATSDFIPLFSMQ
RWNSITSMFFAHASGSIALRITGSVLFALVPPALEKYNLENQKKEILENESKEEETRQPE
VNIQPEEPINTSDMEGVTTEANEIGSYQEPSLINIRGREVDVSSLGIDPTFLLALPEEMR
EEVVFQHIQERHMESISDSSRRIDPSFLEVLPSDLRDELLFQEAVQMRLFDHATRNNNSV
DHEVEMEEIDQGGTVSEHREKSVKPVKKIPVPNLLDRQGLYSLIRLIFISQHNGKNPYYD
LIVNISENKQHRADIVGLLLYILQEASINDRASEKCYRDLTVKSLNNSQQKEVKKSTGLL
ESLCKVPVVNGISAPALILQQGIDLLSHLATWADHFASFFLSMHDFSGIASKKSAGRKNR
ESNVYKIAPINVLLGLLAREELFGNTLVMNTFSELLSTLTKPLLSFYKSEKLQKDSATTG
YTNDQDSRGSTVPKQDPGTTASRKDKKILSPPNILDENLRLAASLITTDSCSSRTFQNAL
SVMFHLSSIPKAKILIGKELLRHGQEYGNSITNDLSRLCADVKSGKNESELQVALAPFCP
ASSNQAKLLRCLKALDYIFERRPKGQEQSPGNIIQLLEFYDNLKFSSLWEVLSECLSALR
DHTSITHVSTVLLPLIESLMVICRLVFIELPEDVGKHISPILERFKTLFISFTEEHRKII
NMMVFTTPSLMSGSFSLLVKNPKVLEFENKRNYFNRQLHEEAAKEQYPPLNITVRRDHVF
LDSYRALHFKDADEVKFSKLNIHFRDEEGVDAGGVTREWLQVLARQMFNPDYALFLPVTG
DATTFHPNRDSSVNPDHLSFFKFTGRIIGKALYDGRLLDCHFSRAVYKHMLHRSVSVKDI
ESLDPDYYKSLVWMLNNDITDIITEEFAVEKDVFGEKTVVDLIPNGRNIPVTELNKQNYV
NRMVDYKLRESVKDQLKSLLDGFSDIIPSHLIQIFNEQELELLISGLPEIDIDDWKNNTE
YHGYNVSSPQVQWFWRAVRSFDEEERAKLLQFATGTSKVPLNGFKELEGMSGFQRFNIHK
SYGSLNRLPQSHTCFNQLDLPEYDTYEQLRSMLLTAINEGSEGFGFA
NT seq 9684 nt NT seq  +upstreamnt  +downstreamnt
atgaggataacgaaaagtcctcctaaaaatcaatattctcagccacctcctagggttgct
gagtttattagacaagctcaaaatgaagaagtaacttcagacttgggtcttgtctctctt
tgttcagaattcagaaaaaacgattggccatatcctcgtggcgatttgtattcatgggtc
ccagttttgaataggtttgatgctattctggaacgtattgttgaacattattctttaaag
gataaagttcagacaaaaccttttgattctgacactttgagtatcttgttagagatcctg
agcttttcggcgcatctgcttagtcattgcgcgaatcgctccatatataactctactgtt
tatctagagtatttattaaatagctctgtgctcgaagttatagattctacattagccttg
cttcttcatattgtacaaaaagcaacgatttcaaagcgaggaaagcagctgttttctctt
tcacaagatcggttatttcgctttttaatgtttcttcctcaagatgcaatgaaaaccgga
ttttcacaaaattacgagactttgttattttcaaatgagatcccgcaagaatggtgttct
ttggagctttcttattataaaagctctccatcaaaagatttttcatctgcaagtcaacca
aattctgaaggattttcgattttaaaattaccatataataaagttcttggaaagcctata
gaagagcttcttgtgaaaactttgcacgataatcagattcctgaacaatattcatttgat
ctccttgtttcactaatgttacgtcaaaatctttatgatataaatagacggcgcttgatg
attcgtatcggattattggctctttctaatcttgtttatgctcattctcaggcagttcaa
acaagatttttaatcgccgatccggaaatcaccacccatttagctaatttggtttctcca
gatgtggatcttcctcaaaactttaaagctgtttgttttgaatgttttaaagctttcttc
tttaagaagagtatgattccatctgtactggcatctttaaatgtatctgttagttacgga
ttaatgatgaatctcgttcgtgatttttctaaaaacttagaaaacccgaatttctattac
gagagagaatatgttgatagtttttatgacttccttcaatttatgacttcatcgcctctt
ggcggtaacatggcctgttctgcaggtctcacttctcttttgggttatcatctgtctgtg
aagactccacaggctacttatgttgtagcaagatcgattgtcatgttggaccatctcatc
gatggttactctatggcattcccagatttttctgagtctaaaggattggatatgctggtt
gaccgtgttcaatacgagcttgaggctggacttcaagatattaaatctggaaaaggtaac
ccagagattgttttaaatatggattatgccatttcatatgaccgttacttccttctaaaa
aatttactcaagtttgtgttacatctaattcaatcaggtggctctgtcgttgagcttcgt
aatttaattgattcttctctcatttcatcccttgcttttctgctagagcaccatgaagtc
tatggctccaacttattcgcatctactactaatataatgtcaacattcatccataatgag
cctacttgctatggaattattcatgaaaagaaattgtcacatgcatttttggatgctgtc
aatcggaaaatactcaattcttctgatgcaataacatcaattcctttagcttttggtgca
atatgcttgaactctcaagggtttgatttatttttagagaaaaatcctatcccacaactt
ttctcaatattcacatcgttaaatcattgtaagtcacttatatcaagcgataatgctgcc
atccttggtacttacatcgacgaacttatgcggcatcaaccctcccttaaagatccaatt
gtgaagatgatatttaaagcctgtgaccaggtttccgctcttcttgacaatttcaatcca
tttcaatatataaatgccaaagaatatccttatttgttgtatcttgaaacattttctagt
tttcttgaaaatattattacaaacgaaggtcacgcaaggtatttaatatccaaagggatt
gtgtcgcacgtgctcaatctcattcaacatcccgtactggcttttggatttatagactct
tctgccttcaactcgttttttgttcttttacatcatgcagttgattttgatgctccagag
gtctttcggcccttgctagactgtataattactcgatgtgaagaaggcattactgagttt
actatagtctcactgaaacaagccacgatttcattgataaaggactcaaatatgggccac
gaagatgcaaataattttctacatttctcaatcgttgggaatttgctgactattttcgct
gagctattttcttcccatgctgcattgaaaaaagctggaaatcttccattagttcaactt
tttattagtccttcacgttatgctggtatttttgatattttatgtaatattaaaagcatt
gcaacatcattggacatacatatatgtttaggtgtttctgatgactttgttctttgcagt
gactccttgactaccatcgttaccgacaaagatgaaaaagaaaagtttgagacaaagaaa
aaggaattaacacaagattcatctttttgtaaatttcagaatatacgttcgaatttttct
caaattgcttatggagtatctaagtttttcacttcattaactcgagctttaggaaataca
agcgtacaagatttcaatgaatacaaaatgattcataaacttggtagtaatatcgctctt
gttgttgatgaacttattaacttatcaagcaagcaaatcacatctcatccgcaatccctc
agtattgcttctttagaggcctccttaatttttgttttaggtgcttcatccataattcga
gaagatgattcaaaggttactcttgtgcttctgatcagtcgtctactgggtgggtgtcga
acaatggatgtattgattagcttaaatgagaccgtttctggcttttttcgtttgtccgat
agagatcctctttccaagagtaatcgtgttttgcttgctctttcatccaccttattgaac
ttgattcttgtattcacaagtgctgactttatgtccgaaacaagtaaaacgttaaacatg
gctttaaaatccgagttcgatatgactgattttaacaacagcggttcaaaacttatgcac
gttttgcatgcccgaatttttatttcagttttgcatttatggcgatctgctgacgactta
caccttccttatatcacaagagcattattgacgaatgttttgtccaactgttaccaattt
gaagatggtatcaaaaatgtagtggattcgattaacaatttgcggacatcgatagctaat
ggtgatattaaagaaccactggatgttgtgacggatgataacacgaatagcaatttttca
ttagaagaaacaaatgcctctgtaacagatatgccagaatccgaaaaacatgaaaatgga
atttttcaagcttaccttctcaaagagatgcctaatgacattgtttcacagtttgagatg
ctaaagtctaagcaaattgagttaacagttcagatggcgtcttacgaaggagatttgaac
caaaatttatgtgattttctgtacactagagatgacgtccaaatgaacgctgatgtacag
ttttctgtaacctcaggtttaattgtggaaattaagaaactggctcagtccacagactgt
aaggcaaagaatcagttaggtcccgcggttggtcttctttcattgtttatcagccatgat
tttactcaaaataaagcgaagaactgtgttctttcagaattaaacttctttcttgaattg
ttgcactcgctaaataatggattaccaagcgatagtcacaaaacaagtatagtctgtata
ttgtacttgttggaagttcttttggctgattctaaaaagccagatgaatttgaatttaat
tctgaagattgctcactaaagcttactgatggagcaataacagtagatttggcatcccaa
aagcatataatgtcttcagttattacactgttgtcactaaattctgcaaatttaggcgtt
gtggtttctgccttccgggttgtagttttattgacgagtgcatctgaaatgatacatact
tttgtaaaattgtctggtcttccttctttgtttaaggctatgcgtgcttgttcgggcttt
tgcaatgaatccttgcatattccatttatcagtattcttcgaagactacttgaatttgat
gaagtcgttgaattgatgatgtttgatgatcttgtaaacattttcaaactgcaaggaaga
gcacgtaaaacagagttgcatggctttatacgggcaaatgcagaaatggttttgagatct
cctgagtgctttattaaaattctgaaggattgctgtgtattaggccattttacacctgaa
tctgaacactattatttagagttaaaagagtctcttcctggggtgttgcaaaatggccaa
accgatttagatccttcaaaggaacagatgagttcagttatcgtgtcatttttgttggac
gaattgatggatttgactgaaactcgtcaattttcagatcgttctcctaactccgaattt
actccggaaaatgattctctctatatgtataatgttttccttttacaatgccttactgag
ttactctctggttacaacgcttgtaaacgttgtttcttgaattttcaacctcgtcgcaaa
gctcctttcttcaatctttctagaaagtataactcttacttggtaggattctttcttgag
aaacttttgccttttggatgtattaggttgtcggaaaacaacgaagttcgaaaggcgttt
tctgtttcaaattgggccatatcgattttagttttcttgtgtgcatactcaaatgagcaa
caaactcaagcagttgatgaaattcgaagggaggttttaaccagtgttttaaagttttat
aaatcaagttcatcattttctgaaaatcttgaggcttactactgcaaactactagtattg
gccgagctttgttatcgtttatgtgatgcacagaccgtttctcaaaaggcaccaaatcat
cttctacgtcgctctcaggaccaaaatgtcaagaccatgattgatcttggttatattcct
acattgacaaacgcaatttctgagattgatatgaattatccagtttctagaaaagttgtt
cgtcacatattaaaaccccttcagttattaacaaaagaagcaatttttctgagtcagaca
aaccctgaggctttatctggagctgcgcaagatagtatgggtgaccaatctctttcatct
agcagtgaagaatcttcagattcagatcgagaagagccaccggatctgtacagaaattct
gttttgggaatatttcaaggcgatatagttaatgagaatgacgagaactacgaggacagt
gaagatgatggtgtttatgaagaaatggagtttgaggatgatcaatctggaagtgccgat
agtgtagtcagtgaagatgatgctgatgatgttatgtacagcgacaatgatgatatgaat
attgaatttatggttgatgaacaggatgcgtctagtcaaaatgacgatagttcatttgat
gaagcctcaagccatggagatgtgatatcaattgacgaagaagatttggataatcaaggg
gaagaatttgaatgggaagatgaggataacgcttcatcaggttatgaggatgaattggat
tataacgaagatgaagtcggagaaaacgattcaacgacttttgaagcgatggaaaatgca
tttactgaaacatcggataacgatgaccatctcgaagaagcggaccatgttagtcctgta
gaaattgattttctggaaaatgacgagaacagttcttctgaacaagacgatgaatttcaa
tgggaatggaatacagaaacaccgtcaggcgccgatattcttagtcgacatggagccctt
ttacgtgatttgtttccactaccaggactttctcgccgggtgatgataataaactctaac
gatccctctcgatctaggccgtttttgaacaacaatgcgtctgagggcttattgaagcac
ccgcttcttcttcgaaataatttgatccacactccaaaagcaactgagctatgggaaaat
cttgctgaaatagataatcatactgcttccggagctgcattccaaagacttctttattat
cttgctttagaaataccaaatgaagattctagtgtacttggttggacttcattaaaagtt
tcgaaacatactgaccctctaagagcaacctctgattttattccattatttagcatgcaa
cgctggaacagtataacttcaatgttttttgcacatgcttctggatcaattgctttaaga
atcactggttcagtattatttgcccttgttcctcctgctcttgaaaagtataaccttgaa
aatcaaaagaaagaaattttggaaaacgaaagtaaagaagaagagactcgtcaacctgaa
gtaaacattcagcccgaagaacctattaatacttccgacatggaaggtgttacaactgaa
gcaaatgaaattggaagctaccaagaaccgtctcttattaatattaggggtagagaagtt
gatgtttcttcccttgggattgatccaacgtttttgttagctcttccggaagagatgcgg
gaggaggtagtttttcaacatattcaagaaagacatatggaatcaattagcgattcttcg
agacgaattgatccttcctttttggaggttttgccatctgatttacgtgatgaattattg
tttcaagaggctgtacaaatgcgtctatttgatcatgctactcgaaataataattctgtt
gaccatgaagtggaaatggaagaaatcgatcagggaggtacagtcagtgagcatcgcgag
aagagtgtaaaacctgttaaaaaaattcccgttcccaatctgctggatcgtcaaggactt
tactcgctaattcgattgattttcatttcacagcacaatggtaaaaacccatattacgat
ttgatagtaaacattagcgagaacaaacagcatcgagctgatatagtgggtcttcttctt
tatattttgcaggaagcttcaattaacgaccgtgcttctgaaaaatgttacagggattta
accgttaaatcactgaataattcccagcaaaaagaagtaaagaaatctacaggtttactg
gaatcgctttgcaaggttccagttgtaaatggtatatcggctccagcgttaatattgcag
caaggtattgatttactttctcatttggcaacatgggccgatcattttgcttcattcttt
ttaagcatgcatgatttttctggtatagctagcaaaaagagcgctggccgtaaaaaccgt
gaatcaaatgtttataaaattgctccgatcaatgtacttcttggacttttagctcgcgaa
gaattgtttggaaacactttggtaatgaacaccttttcagaattactctccacgttaaca
aaaccattgctttcattctataaatctgagaaactacaaaaagacagcgcaaccactgga
tatactaatgatcaagattctcgagggtctactgttccgaaacaggaccctggtactact
gcgtcccgaaaggataaaaagattctgtcgccgccgaatattttagatgaaaatcttcga
ctcgctgctagcctaattactactgattcttgttctagtcgaacttttcaaaatgctctt
tctgttatgtttcaccttagctctattccaaaagcaaagattttaatcggaaaagaatta
cttcgccatgggcaagagtatggtaattctattacgaatgatttatcccgtctttgtgcc
gatgtcaagtcaggtaaaaatgagagtgagttacaagttgcactggctcccttttgtcct
gctagctctaaccaggctaagcttttacgttgcttgaaggccttggattatatattcgag
cgtagacctaaaggacaagagcagtcacctggaaatatcattcaactactcgagttttac
gataacttaaagttttcttccttatgggaggttttaagcgagtgtttgagtgctcttcgt
gaccacacgagtattacccacgtttcaactgttttactaccacttattgaatcgttaatg
gttatctgccgacttgtgtttattgaacttccggaagatgttggaaaacatatttcacct
attctcgagcgattcaagaccttgtttattagcttcactgaagaacatcgcaaaattatc
aatatgatggtgtttactacaccctctttaatgagtggctctttctcgttacttgtcaaa
aatcctaaggttcttgagtttgaaaataaacgaaattactttaatcggcaattgcatgaa
gaagctgcaaaagagcaatatccaccattgaatatcactgttcgtagagatcatgtattc
ttggattcttatcgtgctctacattttaaggatgcggatgaagttaaattcagcaaacta
aacattcatttccgagatgaagagggagttgatgctggcggcgttacgagggaatggttg
caagtccttgccagacaaatgttcaatcctgattatgctctatttttgccggtcaccgga
gatgctactaccttccatcccaaccgtgactcttcagtgaaccctgatcatttgtctttc
ttcaaatttactggtaggattattggtaaggctctatacgatggtagattacttgactgc
catttcagtcgcgccgtttataagcatatgttacataggtcagtgtctgtgaaagatatt
gaatctcttgatcctgattactacaagtctttagtgtggatgcttaataacgatattacc
gatattattactgaagagtttgcagttgaaaaagacgtatttggtgaaaagacagtggtt
gaccttatacccaatggtcgaaatattcctgttacggaactaaataaacagaattatgtt
aatcgaatggttgattataaattaagagaaagtgttaaagaccaactcaaaagtttactg
gatggtttctctgatattattccttcacatttaatacaaatattcaacgagcaagaatta
gaactcttgatttctggtttgccagagattgatatcgatgactggaaaaataacacagag
tatcatggttataatgtatcttcgcctcaagttcaatggttttggcgagctgttcgttct
ttcgatgaagaggagcgtgctaaactattacaatttgcaacaggtacctcgaaggtcccc
ttgaatggatttaaagaacttgagggtatgtcaggatttcaaagatttaatattcataag
agctatggatctttaaatcgtttaccgcaatcccacacatgttttaaccaactggatttg
cctgaatatgacacatatgaacaactcagaagcatgttattaactgcaatcaatgaaggg
tctgaaggttttggatttgcttag

DBGET integrated database retrieval system