KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19G12.01cHelp
Entry
SPAC19G12.01c     CDS       T00076                                 

Gene name
cut20, apc4, lid1, SPAPJ698.04c
Definition
(RefSeq) anaphase-promoting complex subunit Apc4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04111  Cell cycle - yeast
spo04113  Meiosis - yeast
spo04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC19G12.01c (cut20)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC19G12.01c (cut20)
   04113 Meiosis - yeast
    SPAC19G12.01c (cut20)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     SPAC19G12.01c (cut20)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    SPAC19G12.01c (cut20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANAPC4 ANAPC4_WD40 Minor_capsid_1 DUF2939
Motif
Other DBs
NCBI-GeneID: 2542615
NCBI-ProteinID: XP_001713100
PomBase: SPAC19G12.01c
UniProt: O42839
Position
I:complement(join(4042034..4043554,4043600..4043657,4043749..4043871,4043914..4044133,4044182..4044419))
Genome map
AA seq 719 aa AA seqDB search
MVSKSFKYPKKHKFEWINETNRVERVGSGLKRVILCPSMELIAILTCSNHLICCRSNSQR
IWDVDFHDLEATELCWNHDGNLIVVGFKNGELKIIDSSTGHLVEQRPASRDLAVLMITWA
MQETIVNEKRNDFLFDATAYMPLLGTLPSSAKEERIFSSKAIAQFFEPRKREGENNKKVE
LLSILDERGIRYINMFSSYKIGESDSLKSALNLGVPISHSITNDLAYHVLICKGGTNISL
KTLYMPLLKNDLGSIVDIATMSTRMQHLVRYLEEVLNAMYEEFDNVFKSEASFIKTFDAL
VSKYSDTTFFSLQLELYQFIMNGIPSDLLKEWINERVGDRVLKNWERAMVNSYTSLIIFC
QEFVIPACERLTVLLSSARGKSIWGHMKGNTLLDAKLVEDCLATLGYLQNNVFSFLNCLF
EEKKYMKHFISWLNYAIVEFNTSEPSSIPPQEIIEHINETVIYIRHSLFRSKLTSYFMGT
KPLQLRDPDYYSLKDFANQDDSNSVDDFVSFKTLKESLRDSFNVIFSYPSLTCQKQWLKT
GDLVLFEGTDWNVSSLIPKSCNEKNQLFSLFFRKDTPNIFLIISQLMENTMLPVSGCHFG
LDYAELLGSSLLDFQPATVLDMKLLNGSSILILGKLKEKCFLCEICLADVPLTFFEHQQK
NSYLDAISHLPFIPLNSCLWLHEFEKDFLPSTLEYALSENSDYGVLISRESSRYRLFSF
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcaaaatctttcaaataccctaaaaagcataaatttgaatggattaatgaaact
aatagagttgaaagggttggaagtggccttaaacgagtaatcttatgcccttctatggaa
ctcattgcgatattaacgtgttcaaatcatttgatttgctgtagaagtaacagtcaaaga
atttgggatgtcgattttcatgatctcgaggctactgaattgtgttggaatcacgatggg
aatttaatagttgttggatttaaaaatggagagcttaaaattattgattcctccacagga
catctggttgagcaaaggccagcttccagagatttagcggttctaatgataacatgggcc
atgcaagaaacgatagtaaatgaaaaacgcaatgattttttatttgatgccactgcatat
atgcctttacttggtacacttcctagttcggcaaaagaggaacgtatattttcttcaaaa
gcaatcgcacaattttttgagccgaggaaacgagagggtgaaaataacaaaaaagttgag
ctcttaagtattttggatgaacgtggaattagatacataaatatgttttcgtcttacaaa
atcggagaaagcgattctttgaaatcagccttgaacttgggggttcccatttcacacagc
ataaccaacgacttagcatatcatgttcttatttgtaaaggaggaacgaatatttctttg
aaaacactttatatgccattacttaaaaatgatttgggaagtattgtggatattgcaaca
atgtctacacgtatgcaacatttggtaagatatcttgaggaggtattgaatgctatgtat
gaagaatttgacaatgtcttcaaatcagaagctagctttattaaaacctttgatgcttta
gtgtccaagtacagtgacacaactttcttttctttacaactagagttatatcaatttata
atgaacggtatacccagcgacttactcaaagaatggatcaacgaaagagtcggtgatcga
gtactaaaaaattgggaacgggcgatggtgaattcgtacacgtccttaatcattttctgt
caggaattcgtaatacctgcttgtgaaaggttaactgtattattatcttctgccagagga
aagtcaatatggggccatatgaagggaaacacattactagatgctaaattggtggaagat
tgtctagcaactttgggttatttacagaataatgttttttcgtttctcaattgccttttt
gaggaaaaaaagtatatgaagcactttatttcatggttgaattacgctatcgtcgagttt
aatacttctgaaccatcttctattccaccgcaagagattattgaacatattaatgaaacc
gtaatttatattcgtcattctttattccgctcgaaactaacaagttactttatgggcaca
aaaccccttcagctaagagatcctgattattattctctcaaggattttgcaaatcaagac
gacagtaattctgttgatgatttcgtatcattcaaaaccttgaaagaatctttaagagac
tcattcaacgtcatttttagctacccttctttaacttgtcaaaagcaatggttaaaaacc
ggagaccttgttttgtttgaagggactgattggaatgtatcatctcttataccaaaatcc
tgtaatgaaaaaaaccaattattttcattattctttcgaaaggatactccgaatatattc
ttaataatttcccaacttatggaaaatactatgttgcctgtatctggatgccactttggc
ttggattatgcagaattactaggaagcagtctgttggatttccagcccgcaactgtttta
gacatgaagcttttaaacggaagtagtattttaatacttggaaaactaaaggagaagtgc
ttcttatgtgaaatttgcttagcagacgttcccttaaccttttttgagcaccagcaaaaa
aacagttaccttgatgctatcagtcatcttcctttcattccactaaacagttgcctatgg
ctgcatgaatttgagaaggatttccttccttcaacactcgaatatgccctttctgagaat
agcgattacggagtccttatttcaagggaatcttcgagatatcgtttattctctttttaa

DBGET integrated database retrieval system