KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1A6.03cHelp
Entry
SPAC1A6.03c       CDS       T00076                                 

Definition
phospholipase (predicted) (EC:3.1.1.5)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(1070061..1070138,1070205..1072127))
Genome map
AA seq 666 aa AA seqDB search
MLFNCFGILALLQILPALAYPPCREQMSDPYEFGESDLMRPGMHDTPLSLMQKREALAIS
LSKRDSVGSYAPYNVTCPSDYMLRPASDGISSGEQSFIDKRIPKINTQMRSFISNTGLDV
DVNSVINDSDGPRLGLAFSGGGLRAMVHGGGVLNAFDSRNGNGSSLAGILQSAMYIAGLS
GGSWLVGSVAVNNFANITYLRDNVWNLEHSVFAPHGDNVVENLAYYDDLDDEIDQKKDAG
FDTSLTDLWGRALSRKLVDATQGGPNITFSSIRNQTWFQNADYPYPIIISDSRLEEEKAI
PANTSIFEFTPYEFGTWDNGIKAFLPMEYVGTHLKNGVPPDHKCIRNYDNAGFVMGTSAT
LFNTFLLEWSQEVTSNSTLYDIIHKVFEKLSEDQNDIAPYPNPYQNFTTTNTTVKNPFER
FDTIDLVDGGEDDENIPIWPLLHPQRFVDVIFAVDATYDDSNGWPDGSSIVTTYERIITY
NANKSVDVRGFPYIPDEDTIISLGLNTHPTFFGCDGRNTTAGNHTVDNNTPPLLVYFPNY
PWVYYSNISTFTMSMNDTLSSGILENAALSATQNNSDSFAVCLACAMIQRSLERKNMSTP
SQCSSCFEQYCWNGTTVNNPSAVSNYAPTVLSASTTSGTSSTTKASPTHTPWYESLFDLK
ELKSID
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgttatttaattgttttggaatactcgctctgctccagatcctgccggccttggcgtac
ccgccttgtcgcgagcaaatgtcggatccgtatgagtttggggaatctgacttaatgaga
ccgggcatgcatgacacgcctctttcattaatgcaaaaacgagaggctttggcgatttcg
ctttccaagcgcgacagtgttggatcatacgcgccttataatgtaacttgtcctagtgac
tatatgctacgacctgcttctgacggaataagttcaggcgagcaaagtttcattgataaa
cgtatccccaaaatcaatacacaaatgaggtcctttatttccaacactggtttggacgta
gatgtaaactctgtgattaatgattcagatggccctcgtttaggacttgcattttctggc
ggtggactccgcgctatggtccacggaggaggtgttttaaatgctttcgattctcgaaat
ggcaatggttcttcacttgctggaattcttcaatccgccatgtatatcgctggtctttct
ggtggttcatggctggtcggttccgtagctgttaataactttgccaatattacttatcta
cgtgacaacgtttggaatttggaacatagtgtctttgctcctcatggtgacaatgttgtc
gaaaatcttgcttattatgacgacctggatgatgagattgatcaaaagaaagatgcagga
ttcgatacttctttgaccgatctttggggacgcgctttatctcgtaagcttgtcgatgct
acccaaggtggtccaaatatcacattttctagcattagaaaccaaacttggttccaaaat
gccgactatccttatcccatcattatatctgacagtcgtttggaagaggaaaaagctatc
cctgccaacaccagtatattcgaatttactccatacgagtttggtacttgggacaatggt
attaaagcttttctccctatggaatacgtcggtacccatttaaagaatggtgttccacca
gaccataagtgcattcgtaactatgataatgccggttttgttatgggtacttcagctaca
ttgttcaacacgtttctgttagaatggagtcaggaagtaacgtcaaatagtactctctat
gatattattcataaagtatttgaaaaactttctgaggatcaaaatgacatcgctccttac
cccaatccttatcagaatttcacgactacaaacaccaccgtcaaaaacccttttgagcga
ttcgatactattgatttagtagatggtggtgaagacgatgagaacattcctatttggcct
ttgttacatcctcaaagatttgttgacgttatatttgctgttgacgcaacttatgatgat
tctaatggttggcctgatggctcttctattgttactacatatgaaaggattataacttat
aacgccaataaaagtgttgatgttcgaggtttcccgtatatccctgatgaggacacaatc
atttccttgggactgaacactcatccaacattctttggatgtgacggcagaaacactact
gcaggtaatcataccgtagataacaatacacctcctcttcttgtttatttccccaattat
ccttgggtttactattccaatatttccacgtttaccatgtctatgaatgacactttgtcc
agtggcattcttgaaaatgctgctctatcggctactcaaaacaacagcgattcatttgca
gtctgtttggcatgcgccatgatacaacgttccttggagcgcaaaaatatgtctactcct
agtcaatgctcttcttgttttgaacaatactgctggaatggaacaaccgtgaacaaccct
agtgccgtttcaaactatgctcctactgtgttatctgcatcaaccacttctggtacctct
tctacgacgaaagcctcccccactcacacaccttggtatgagtcacttttcgacttgaaa
gaattaaaaagcatagactga

DBGET integrated database retrieval system