KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1A6.09cHelp
Entry
SPAC1A6.09c       CDS       T00076                                 

Gene name
lag1
Definition
sphingosine N-acyltransferase Lag1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPAC1A6.09c (lag1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     SPAC1A6.09c (lag1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(1087819..1088991)
Genome map
AA seq 390 aa AA seqDB search
MSNRKADEKHHMSSSSLTNDRSYIRNLSNRKTSISRKVPITRTLEDPSNFVAKDGTKLVQ
APLFLLVWQKEICLSIIAICFACLLSPSLRPYAEPFIFLSYKQPDGSYGKGPKDACFPIF
WVIVFTAFRVIVMDYVFRPFVLNWGVRNRKVIIRFCEQGYSFFYYLCFWFLGLYIYRSSN
YWSNEEKLFEDYPQYYMSPLFKAYYLIQLGFWLQQILVLHLEQRRADHWQMFAHHIVTCA
LIILSYGFNFLRVGNAILYIFDLSDYILSGGKMLKYLGFGKICDYLFGIFVASWVYSRHY
LFSKILRVVVTNAPEIIGGFHLDVPNGYIFNKPIYIAFIILLFTLQLLIYIWFGMIVKVA
YRVFSGEEATDSRSDDEGEDEEASSTNEDK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgaaaagctgatgaaaaacatcatatgtcttcatcttctttgacaaacgat
cgctcctacattcgtaacctttcaaacagaaaaacaagcatctcccgaaaagtccccatt
accagaactcttgaagatcccagcaattttgttgcaaaggatggaacaaaattagtgcaa
gccccactgtttctgcttgtctggcaaaaagaaatttgcctttctattatagcgatttgt
ttcgcctgtttgctttctccttccttacggccctatgcggagccatttatttttctttca
tataaacaacccgatggctcttacggtaaaggcccaaaagatgcctgctttcccatattt
tgggttatagtgttcacggcgtttcgtgtcattgtcatggactacgtattccggcccttc
gtattaaattggggagttcgtaatcgcaaggtgataatacgattttgtgaacaaggctac
agttttttttactacctttgtttttggttcctgggtctatatatatatcgcagtagtaac
tactggagcaatgaggagaaactttttgaagattatcctcagtattacatgagtcctttg
ttcaaagcttactatttgattcagctagggttctggcttcaacaaatccttgtccttcat
ttagaacaaagaagggccgatcattggcaaatgtttgctcaccatatagtcacttgtgca
ttgattattttgagttatggatttaactttttgcgtgtcggaaatgccattttgtatata
tttgatctctctgattacattctttccggtggtaagatgttaaagtaccttgggtttggg
aaaatttgtgattatcttttcggtattttcgtggctagctgggtgtattctaggcattat
cttttttccaaaattttgcgtgttgttgtaactaatgctcctgaaatcattggtggcttt
cacctagacgttcccaatggttatatttttaacaaacctatatatatagcatttatcatc
ctcctctttactttacaattgttaatttacatatggtttggtatgattgtaaaggtcgct
tatcgtgttttttctggagaagaagctactgacagtcgttctgatgatgagggcgaagac
gaggaggcgagttcaacgaatgaggataaataa

DBGET integrated database retrieval system