KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1D4.11cHelp
Entry
SPAC1D4.11c       CDS       T00076                                 

Gene name
lkh1, kic1
Definition
dual specificity protein kinase Lkh1 (EC:2.7.10.1 2.7.11.1)
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SPAC1D4.11c (lkh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(656760..658832)
Genome map
AA seq 690 aa AA seqDB search
MHSLKRRRNHAPDWQDFYKNGVPQEVIVIEDSASPRLTPNLPPPFSVHQLQSFVPPQPPS
SSSPSTTGTVAVPINGANAVYPSTNSVSLPQSYDPWLDANGVVPLPHDVASHPSYMVQSP
TSYHACSNNQSPFPHSHHPPLHNPLPVSCQPVLRPPPVPQVPSHWYPVSLPSPNLPHQPI
SKPPVIPNLPKLQVHPNRLPHPIHNHPYSSPTSYPPPLCPATYCPSNPPQLAPATAIAPS
SQSSQHKSVNYSVTPSSINNHTAVPLSPTLAVWLPMTQPTFQPPSANVYQPASNANQVIT
PVSISDYRPPKKRKRAAWPPYKKVDRVNVPVVHDTTAFDPSTFDDDDGHYKVVPNSKFAN
RYTVVRLLGHGTFGKVIQCYDQSTGRHCAIKVTRAIPKYREASLIELRVLQTIAHSDPTN
ENKCIQLRDYFDYRKHICIVTDLFGWSVFDFLKNNNYIPFPLKHIQMLSQQLFKSVAFLH
SLGLVHTDLKPENVLLVSNASRTIRLPYRNYSQKVLNSCEIRLIDFGSATFEDEYHSSVV
STRHYRAPEIILGLGWSYPCDVWSIGCILVELFTGQALFQTHEDSEHLCMMEKILGPFDR
NMISRSSRTSQRFFKSDGKVRYPLSNTPKKSINYLQSLQTLEQIFAVSSPEVALLLDLLK
KVFVYDPKRRITAKEALWHPFFTQPISSNL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgcattccttaaaacgtcgtagaaatcatgcgcctgattggcaggacttttataaaaat
ggtgttccacaagaagtcattgttatagaggactcagcttctccacggcttacccctaat
ttaccgcctcctttttctgttcatcaattacaatccttcgtacctccgcaacctccctca
tcatcatcaccctctaccactggcactgtggcagtccctatcaatggtgcgaatgctgtt
tatccatcaactaactcggtatctcttcctcaatcctatgatccatggttggatgctaat
ggcgtcgttccattaccgcatgatgtcgccagccatccttcatatatggttcagtctcct
acatcgtatcatgcgtgttcaaataatcaatcgccatttccccattcacatcatcctccc
cttcataatccactacctgtttcatgtcaacctgttttacggccgcctcctgtccctcaa
gttccttcacactggtacccggtttcgcttccctctcctaatttacctcaccaaccaatt
tctaaacctccagtgatccctaatttaccaaagctccaagtccatccgaacaggcttcca
catcccatccataatcatccttactcgtctccaacctcttatcctcccccactatgtcct
gcaacgtattgtccttctaaccctcctcagctagctccggctactgctatcgctccttcc
tcgcaatcgtctcaacataaaagtgtaaattattccgtcaccccaagttccattaacaat
cataccgctgtaccattatctccaacgctggccgtatggcttccgatgactcaaccaact
ttccaacctccttctgcaaacgtttatcaaccggcttctaatgccaatcaagttatcact
cctgtatctatttccgattatcgacctccgaagaaaaggaagcgagctgcatggccccca
tataaaaaagtcgaccgcgtaaatgttcctgttgtgcatgatactaccgcttttgatcca
tcaacttttgatgatgatgacggtcattacaaggttgtacctaactccaaatttgccaac
cgttatacagttgttcgtttgcttgggcacggtacttttggcaaagttatccagtgttac
gatcaaagtacaggtagacattgtgctatcaaggtgactcgagcaattccaaagtacaga
gaagctagtctcattgaattaagagttttacaaactatagctcatagtgatccgacaaat
gaaaataagtgcattcagttacgcgattatttcgattaccgcaagcacatctgcattgtg
actgatctttttggctggagtgtctttgattttttaaagaataacaactacattcctttc
cctttgaagcatattcagatgctatcccaacaactttttaaaagtgttgcgtttcttcac
tctttgggactagtacataccgatcttaaacccgaaaatgttcttctggtatctaatgcc
tcaagaactattcgattaccttatcggaattattcacagaaagtccttaatagttgtgaa
atccggcttatcgactttggtagtgcaacatttgaagatgaataccattccagtgtagtg
agtactcgtcattatcgtgctccagagattattttagggttgggttggtcttatccttgc
gatgtttggagtattggatgtattttagttgagttattcacgggacaagccttgtttcaa
acccatgaagatagtgagcatctgtgcatgatggaaaaaatcctgggtccctttgatagg
aatatgatttcgcgttcctctcgtacatcgcaacgtttttttaaatctgacggaaaagtc
cgttatcctttgtcaaatacgcctaaaaaaagcattaattatcttcaatctctgcaaacg
ctagagcaaatatttgcagtatcatctccagaagtggctttgctgcttgatttattgaaa
aaagtattcgtttacgatcctaagcggcgaataactgcaaaagaggccctttggcatccc
tttttcacccaaccaatttcttcaaatttgtga

DBGET integrated database retrieval system