KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F5.02Help
Entry
SPAC1F5.02        CDS       T00076                                 

Definition
protein disulfide isomerase (predicted) (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC1F5.02
Enzymes [BR:spo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SPAC1F5.02
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SPAC1F5.02
  Exosomal proteins of colorectal cancer cells
   SPAC1F5.02
  Exosomal proteins of bladder cancer cells
   SPAC1F5.02
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(292260..293738)
Genome map
AA seq 492 aa AA seqDB search
MKISNLLAAFLAFSGGFFCASAEVPKVNKEGLNELITADKVLMVKFYAPWCGHCKALAPE
YESAADELEKDGISLVEVDCTEEGDLCSEYSIRGYPTLNVFKNGKQISQYSGPRKHDALV
KYMRKQLLPTVKPISKDTLENFVEKADDLAVVAFFKDQKLNDTYTEVAEVMKDDFVFAAS
DDKELAKSLGSNFPGIVAFTKDAAQDSDKLVYTGDWDPASIADFIGVSSIPLLDELNQMT
FGKYQQSGLPLGIIFYNSTESRDELYDVFQPLAKKYQDTLRFAFLDAVRYGAVAKQMNVE
SDWPAFVIANLKSMLKYPFPTTELTAKAMTKFVGDFVDGKLQPKIKSQPIPESQEDLVVL
VADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATENDI
SVSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFIDKHASFEPIKKEKESVPAPDLED
QVAVEDEMADEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagattagtaatttgttagcagcctttttggctttctctggaggattcttttgtgcc
tctgctgaagttcccaaagtaaataaagaaggtttgaatgagttaatcactgcagacaag
gttttaatggtaaagttctatgctccttggtgtggtcattgtaaggcattggctcctgag
tatgagtcagctgctgatgagttggagaaggacggtatctctttggttgaagtagattgt
actgaagaaggcgatttgtgttctgaatacagtattcgtggatatcccacactaaatgta
ttcaaaaacggaaaacaaatttctcaatattctggacctagaaaacatgatgctttggtt
aaatatatgaggaaacaactccttcccactgttaagcccatatctaaagacacccttgaa
aattttgttgaaaaggccgatgatttggctgtagtagcatttttcaaagatcaaaaattg
aatgacacctataccgaggttgccgaagtaatgaaggatgactttgtctttgctgcttct
gacgataaggagcttgctaagtctttgggttccaatttcccaggaattgtagcttttact
aaagacgctgctcaagattccgataagcttgtttacactggtgattgggatccagctagt
attgcagactttattggtgtatctagtattcccttgcttgatgagctaaatcagatgacc
tttggtaaatatcagcaaagtggtttgcctttgggaattatattttataactccactgaa
tctcgtgatgaactatatgacgtttttcaacccctagctaaaaagtatcaggataccctt
cgtttcgctttcttagatgctgtacgttatggagcagtagctaagcaaatgaatgttgaa
agtgactggcctgcgtttgtaattgcaaaccttaaaagcatgctcaaatatcctttccct
actactgaattgacggcaaaagccatgactaaatttgttggtgattttgttgatggaaag
ctacagccaaagattaaaagtcaacccattcctgaatctcaagaagatttagtggtgtta
gtagctgataattttgatgatattgttatggatgaaactaaggatgttcttgttgagttt
tatgctccttggtgtggtcactgcaagaatctcgctccaacttacgaaaaattagctgag
gagtattctgatgactctaatgttgttgtagccaaaatcgatgcaactgaaaatgatata
tcggtctctatttctggcttccctactattatgttctttaaagctaatgacaaagtaaac
cctgtacgttatgaaggtgaccgtacgttagaggacttgagtgcctttatagataaacat
gcctctttcgaacccatcaagaaggagaaagaatctgttccagcacccgatcttgaggat
caggtcgcagtggaagacgaaatggccgatgagctttaa

DBGET integrated database retrieval system