KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F5.07cHelp
Entry
SPAC1F5.07c       CDS       T00076                                 

Gene name
hem14
Definition
protoporphyrinogen oxidase (predicted) (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC1F5.07c (hem14)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SPAC1F5.07c (hem14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:276893..278365
Genome map
AA seq 490 aa AA seqDB search
MSIAICGGGIAGLSTAFYLARLIPKCTIDLYEKGPRLGGWLQSVKIPCADSPTGTVLFEQ
GPRTLRPAGVAGLANLDLISKLGIEDKLLRISSNSPSAKNRYIYYPDRLNEIPSSILGSI
KSIMQPALRPMPLAMMLEPFRKSKRDSTDESVGSFMRRRFGKNVTDRVMSAMINGIYAGD
LNDLSMHSSMFGFLAKIEKKYGNITLGLIRALLAREILSPAEKALKAALLAEPKTAELSN
SMKSTSMFAFKEGIETITLSIADELKKMPNVKIHLNKPAKTLVPHKTQSLVDVNGQAYEY
VVFANSSRNLENLISCPKMETPTSSVYVVNVYYKDPNVLPIRGFGLLIPSCTPNNPNHVL
GIVFDSEQNNPENGSKVTVMMGGSAYTKNTSLIPTNPEEAVNNALKALQHTLKISSKPTL
TNATLQQNCIPQYRVGHQDNLNSLKSWIEKNMGGRILLTGSWYNGVSIGDCIMNGHSTAR
KLASLMNSSS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgcaatttgtggaggaggtatagctggtcttagtacagcattttatcttgct
agattgattccaaaatgtactattgatttgtacgaaaaaggtcctcgtttaggtggatgg
cttcagtcggtcaaaatcccgtgtgcagattctccaacaggaacggttttgtttgagcaa
ggtcctagaactcttcgtcctgctggggttgctggcttagcaaacttagatttaattagc
aagttgggcatcgaagacaagttgttaaggatttcgagcaattctcccagcgcaaaaaac
cgatatatttattacccagatcgcttaaatgaaattccttcaagcattttagggagtata
aagtcgattatgcagcctgctttgcgtccgatgcctttggctatgatgcttgagcccttt
cgtaaaagtaagcgagattcgacagatgaaagcgtgggttcatttatgagaagaagattt
ggtaaaaacgttacggatagagttatgagtgcaatgataaatggtatttatgctggtgat
ttgaatgatttgtctatgcattctagcatgtttggatttttagcgaagattgaaaaaaag
tatggaaacattactttgggattaattagagctcttcttgcacgtgaaatattatctcct
gctgagaaagctttgaaagcagcactactcgcagagccaaaaacagcagagctgtcaaac
agtatgaaatcgacaagtatgtttgctttcaaggaagggattgagactattacattgtca
atagcagatgaattaaaaaaaatgccgaatgtcaagatacatctaaacaaaccggccaaa
actttggttccacataaaactcagtctcttgtagacgtcaatggtcaagcttacgagtat
gttgtgtttgcaaactcttctcgcaatttagagaatctaatatcttgtcctaaaatggaa
actccgacgtcgagtgtttatgtcgtcaacgtttattataaggaccctaatgttcttcca
atccgtggttttgggcttttgattccatcatgcactccaaataatccgaatcatgttctt
ggtatcgtttttgatagtgagcaaaacaaccctgaaaatggaagcaaggtcactgtcatg
atgggagggtctgcttatacaaaaaatacttctttgattccaaccaaccccgaagaagcc
gttaacaatgctctcaaagctttgcagcatactttaaaaatatccagtaagccaacactc
acgaatgcaacattacaacaaaattgcatccctcaatatcgtgttgggcatcaagataat
cttaattctttgaaatcttggattgagaaaaatatgggagggcgaattcttctaactgga
agttggtataatggtgttagtattggggattgtattatgaatggacattcaacagctcga
aaactagcatcattgatgaattcttcttcttga

DBGET integrated database retrieval system