KEGG   Schizosaccharomyces pombe (fission yeast): SPAC20H4.10Help
Entry
SPAC20H4.10       CDS       T00076                                 

Gene name
ufd2
Definition
ubiquitin-protein ligase E4 (predicted)
Orthology
K10597  
ubiquitin conjugation factor E4 B [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC20H4.10 (ufd2)
   04120 Ubiquitin mediated proteolysis
    SPAC20H4.10 (ufd2)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPAC20H4.10 (ufd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(2128463..2128480,2128523..2129266,2129313..2131509,2131550..2131623)
Genome map
AA seq 1010 aa AA seqDB search
MSDLEKIRLKRLAKLQQTNSEANSSKEPKESNIAPEPKKPDLKKRFIGSKATTSNSEQKE
ISPPVTSGAPKHRLFSKDEWMHFITCQALNITLSETDSSKYYLEGFKKDLEEEGSPLLFN
ENNVDSALLSRLSTTGNNTFSYLLQSWSFLYQYKKRLPKDENQDFKIHYLSLLKSLLVSY
AGIVVMLPDTFNSETIDLAEVLIGAEGIPLEFLSEFVQRFEHENLDELFIPVLESLSLKI
GLMNVDTVQMNVMQIILQLVSLKPIALLLPKLPSWNPTNNAGEIEYKTFLGRISSLSVFT
QDVASRYFSNSTERSAQNISSSISSLKLTMSTYQDVLFQIFNTLIRTSTSLRESVLDFFA
MVVNANHKRQSIQVNHFDITSDACMLNFSHVLSRLSEPFLDIGCSKIDRVQVEYFRRNPR
VDIKEETKLNADQKASESFYSKPAEGSNNFISDIFFLNLAFHHYGVNATFKALEQLVQSI
RDSEKLKERLETEQQNMSGSFQATRLTAQLSRLDQRLDLDRSFVHCYEIMLTQTSDTSRS
FSFLNFVAIWLSRLADGQSSTYPKMPLSLPFNENAPEAFKCLPEYFIETITDYMLSLFKT
SSSTLTLHSLEPLCEFCVSFLTQANYIKNPYLRAKLAEILYFGVQTHVGRSELLLDVVRT
SKVATRWLLPALMAFYIEIESTGQSTQFYDKFNIRFYICEVFRTIWKQPAYFGKLEQEQK
TNLPFFVKFVALMLNDATYLLDEALLKLTEIHNLQSLLADAISNSNSNQNVQESQSNLAA
AERQASTYCQLGNETIFMLKLFTSSIPKAFCAVEIVDRLAAMLNYNLQALCGPKCSNLKV
EDPTKYHFNAKTLLSIIFDVYLNLCNEPAFVEAVAHDGRSYSKEIFERATSIMTKHNLKS
SFDIEAIKEFVNRVEAFRLQEATEEEDMGDIPDYFLDPLMFTIMKDPVVLPRSGISIDRS
TIKAHLLSDATDPFNRTPLTLDDVTPNDTLREEINTFLKSKRNKHSRNSE
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttggaaaagattcgtcttaaaaggcttgctaaattgcagcagaccaattcg
gaggcaaattcttctaaagaacctaaggaaagcaatattgcacctgaacctaaaaaacct
gatttaaaaaagagatttattggttcaaaggctacaacatcaaattcagaacaaaaagaa
atatctccacctgttacatctggtgctccaaaacatcgcttgttttctaaggatgaatgg
atgcattttataacatgtcaggctcttaatattacattaagtgaaactgattcatcaaaa
tactatttagaaggttttaaaaaagatttagaagaagagggatcccctttattatttaat
gagaataatgttgactctgcgttactctctcgactgtcaacaactggcaacaatactttc
tcttatttgttacagtcttggagttttctgtatcagtataaaaagagacttccgaaggat
gaaaaccaggactttaaaattcactatttatctctgttaaaaagtttgcttgtcagttat
gccggtattgtagtaatgcttcctgacacattcaattcggagacaattgatttggccgag
gttttaattggtgcagaaggtatacctttggaatttctatcagaatttgttcagaggttt
gaacacgaaaacttagatgaattgtttattcctgtgttggaatctttatctttgaaaatt
ggtcttatgaatgtagatactgttcaaatgaatgtgatgcagattatattacaacttgtg
tcattaaaaccaattgcattacttttgccgaagttgccttcttggaatcctacgaataat
gctggagaaattgagtacaaaacgtttcttggaagaatatcaagcttgtcagtgtttact
caagatgtcgcttctcgatatttttccaattctactgagagatcagcccaaaatatatct
tcgtcaataagttctttaaaattgactatgtctacttatcaggatgtcctttttcaaatt
ttcaataccctcattcgaacatctacatctttgagagagtctgtgttggatttctttgcc
atggtggtaaatgccaatcacaagcgacaatccattcaagttaatcattttgatattaca
tctgacgcctgcatgctaaatttttcacatgtgttaagcagactttctgaaccatttctt
gacataggatgttcgaaaattgacagagtacaagttgaatattttaggagaaaccctcgc
gttgatatcaaagaagagactaaattgaatgctgatcaaaaggcttcggaatcgttttat
tcaaaaccagccgagggttccaataactttatttcagacatattttttttaaatctcgca
tttcatcattatggtgtaaatgctacctttaaggctttagagcaacttgtgcaatcaatt
cgtgatagcgagaaactgaaagaaagattagagactgaacagcaaaatatgagcggtagt
tttcaagcgacacgtctcactgctcaattaagtcggcttgatcaaagattggatttagat
agatcgtttgtgcactgttatgagattatgcttacgcagacatctgatacttcaagatca
ttttcttttcttaatttcgttgccatttggttatcgaggttagctgatggtcaatcttcg
acatatccaaaaatgccgctatcgttaccgtttaatgaaaatgcaccggaagctttcaaa
tgtttacctgaatattttattgaaaccattacagattatatgttgtctttatttaaaacc
tcgtcgagtactttgacgctgcattccttagagcctttgtgtgaattttgtgtgtcgttt
ctaactcaagctaattatatcaaaaatccttatttgcgagcgaaacttgccgagatttta
tactttggagtgcaaacgcacgtgggaagatcagaattgttgttagatgttgtacgtacg
tcgaaggttgcaacaaggtggttacttccagcacttatggcgttttatattgagattgaa
tctacaggacaatctacccaattttatgataaattcaacattcgtttctatatatgcgaa
gtatttagaactatttggaagcaaccagcctattttggtaagctggagcaggagcaaaaa
acaaatttgccgttttttgttaaatttgtagctctcatgcttaatgatgctacatatctt
cttgatgaggctcttttaaaactaaccgagattcacaaccttcagagccttttggcagat
gcaataagcaatagcaactctaaccagaatgttcaagaatcgcaaagcaacttagcggcc
gcagaacgtcaagcttctacttattgccagttagggaatgaaactatttttatgctcaaa
ttgttcacttcctcaattcctaaagccttttgtgccgttgaaattgtagatcggttggca
gctatgctaaactataaccttcaagctttatgtggccctaagtgtagtaacctcaaggta
gaggacccaacgaaatatcattttaatgcaaaaacccttttgtcgattattttcgatgtt
tatcttaacctgtgcaatgaacctgcatttgtcgaagctgttgctcacgatggccgttct
tatagtaaagaaatatttgaacgtgcgactagcattatgactaagcacaacctcaagtca
tcttttgatatagaagctattaaagaatttgtgaatagggtagaggcattcagattgcaa
gaggctactgaagaggaagacatgggtgatattcctgactacttcttagatcctcttatg
tttacaataatgaaagatcctgttgttttaccgagatctggcatttcgattgataggtct
actattaaagcacatctactaagtgatgccaccgacccatttaatcgaactccattaacg
cttgatgatgtgacaccgaatgatacattacgtgaggaaattaacacgttcctgaaatca
aaacgcaacaaacattcgcgaaatagtgaatga

DBGET integrated database retrieval system