KEGG   Schizosaccharomyces pombe (fission yeast): SPAC21E11.05cHelp
Entry
SPAC21E11.05c     CDS       T00076                                 

Gene name
cyp8
Definition
cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp8 (EC:5.2.1.8)
Orthology
K10598  
peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC21E11.05c (cyp8)
Enzymes [BR:spo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPAC21E11.05c (cyp8)
Spliceosome [BR:spo03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    SPAC21E11.05c (cyp8)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    SPAC21E11.05c (cyp8)
Chaperones and folding catalysts [BR:spo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SPAC21E11.05c (cyp8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(4255729..4256152,4256218..4257132,4257273..4257484))
Genome map
AA seq 516 aa AA seqDB search
MGKNTDKLYITQTEHSGVHGWHGGMSGIAQKNSTTSYKQLPFNYCSLSLQPFNHPCCLVD
ETKQAIIFDFRFIVPWLRKHGTNPINGQKASMSDLIKLKFAKNSAEEYCDPVTMKSFTRF
SHIVAIRSTGNCFSWDTIERLNIKPKHWRDLVNEEQFTRDDIITIQDPHNVENRDFSAIQ
KQKETARDEKITKAKIALQASRAKSTESTSSPELSHSLDSSKSIASDMPIHRASHTTGYA
AASLTSTSFTPVTKNERAIIAEEDYMLNHTRIKHKGYARIVTNHGEINIELHTDYAPHAV
YNFVQLAKQGYYRNTIFHRNIARFMIQGGDPSGTGRGGQSIWGKPFKDEFCNPLKHDDRG
IISMANRGKNTNGSQFFILYGPAKHLDNKHTIFGRVVGGLNVLDALEKVPTNSNDHPKLP
IKLEDIIIFVDPFEEWKKDEREKEKRKRQEEEEENNLDRTSWTGRDLSASSTDHSLNASV
GKYLKKEVSLEEKTFTSTVNPKKKKARTGFGNFDAW
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaatacagacaaactgtacattacacaaactgagcattcgggtgtgcatggg
tggcatggtggtatgagtggcatagcccaaaagaacagtaccacaagttacaaacaactt
ccttttaattattgctctctttccttgcagccctttaaccatccttgttgtcttgtggat
gaaaccaagcaagccattattttcgattttagatttattgttccttggcttcgaaaacat
ggtactaatcctattaatggacaaaaggcatcaatgtcagatttaataaagctcaagttt
gcaaaaaacagtgctgaagagtattgtgatccagttacgatgaaaagctttacgcgcttt
tcacacatcgtggctatccgttctacagggaattgtttttcttgggatactattgaacgt
ttgaacataaaaccaaaacattggagggatctcgtgaacgaagagcaatttaccagagac
gacataattaccatccaggatcctcataacgttgagaaccgagatttttcggccattcaa
aaacaaaaggaaaccgcaagagatgaaaaaataaccaaggccaaaattgctttacaagca
tctcgcgccaagtcaacggagtcaacttcatcacctgagttatcgcattctctcgattca
tctaaatctatagcttctgatatgccaattcatcgcgcatcccatacaactggttatgct
gcagcttccttaacctccacatcatttactcctgtaacgaagaatgaaagagcaattatt
gctgaagaagattatatgcttaaccatacgcggatcaagcacaaaggatacgcgcgtatt
gttactaatcacggagaaattaatattgagttgcatacagactatgcaccccatgctgtt
tacaattttgtccagcttgccaagcagggctattatcgtaatacaatttttcatcgcaat
attgctagatttatgattcaaggaggtgatcctagtggaactggaagaggtggtcaaagt
atttggggcaagccgtttaaggacgagttttgtaaccctttaaagcatgacgatcgtgga
attatatctatggccaatcgtggaaaaaataccaatggaagtcaattctttatattgtat
ggaccagcgaaacatttggacaataaacatacaatatttggtcgagttgtcggtggttta
aatgttttggatgctcttgaaaaagtccctaccaacagtaatgatcaccccaagttacca
atcaagcttgaagacatcataatatttgtagacccattcgaagagtggaaaaaagatgag
cgggagaaggagaaacgaaaaagacaagaagaagaagaggaaaataatttagaccgcact
tcttggactgggagggatttatcggcgtcttctacggatcattctctaaatgcgtctgtt
ggaaaatatctaaaaaaggaagtatcacttgaagaaaagacattcacttctactgtaaat
cccaaaaagaaaaaagcacgcacaggatttggaaattttgacgcatggtaa

DBGET integrated database retrieval system