KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22A12.07cHelp
Entry
SPAC22A12.07c     CDS       T00076                                 

Gene name
ogm1, oma1
Definition
protein O-mannosyltransferase Ogm1 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:spo00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(1166822..1169503)
Genome map
AA seq 893 aa AA seqDB search
MDKQSTFQDPKEKHRIQRDVKLSRPRKRFSFLDYVVVIFLTVVAFCVRAQRLMNPAKVVF
EELRYYNYAVDYVNNKLLMDVYPPLGKLLFSLVAALTGNKYELNTLDEPGQQYPFTDVAY
SMRLFTCLLGSLLVPLMYGTVYFPTKSKTAASLAALFVIFDNGLITMSRYIMIEIPALYF
MSLTAFYWSVYEAQQKRPFSLRWHTSLLSTGVALGLALSTKLSAMFTFGWLLILAAFHLW
NLLGDLSVPMYRIVKHLFSYIFYLIGVPITVYLAVFAVHSHIAYKASVADAFLPPEHRHA
LAGNRFDDQFADVAYGSLVTIRNAIPEHGYLHSSELLYPEGTEQQIISLVDEPNQNALWI
IEHEHSQDNNRSNIELLKDGSVVRLRHVMTGRALHSHEHKPIVSNNDWQLEASAYGGFGF
EGDANDLFRIQILEKKSKHATSNGTVETLNTKFRLIHVFANCELMSSHRRFPDWGDYQRE
VTCCRNCVERSTTWFIESNYHDGLPSDSRKITYRKPGFLESFVEHNKLMWLKDRKMGDGH
VYESSALTWPLLLGPLRFFYEQHLQVFFMGNPFVWYSVISLVAFFVIVQIFCLARWNLGY
NDFGPSAFHYNYNIGKFVVAWLLHWAPYILETDRVFLYHYLPALYFGIAALGVSWSFLGN
AVFGNRTAYKALSVIIMALMFLVYRLYSPFTYMTTLTKSSCRALELKGSWNFHCNTYLDN
LSDYKFSSDAGETYFEKAAPHPFVYSEDTAKKSEGDTPLNKNLNDYYPSWDQRVEAGYKL
AAQQKAEQEAREAAEKAASEAAERSSSEAAASSSSESVAAASVEAERLAMEADEFNGASE
TVDGASVEAERSAMEAAALNNAAESTEVVGSSPESVASEQEENVAESAQARVE
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaatccacttttcaggatcccaaggagaagcatagaatccaacgtgatgta
aagctttctcgccctcgtaagcgattttcatttttggattatgttgtagttattttctta
accgttgtggctttttgtgttcgtgctcaacgactgatgaacccggcaaaggtcgttttc
gaggagttaagatattacaattatgccgttgactatgtgaacaataaactgctgatggat
gtctaccctcctttaggtaaacttctcttcagtttggttgctgctctaactgggaacaaa
tatgaactgaacacattggatgagcctggtcagcaatatccttttacagatgttgcttac
tctatgcgtctattcacatgtttacttggatctctccttgtacccttaatgtacggaaca
gtttattttccaacaaagtctaaaacagcggcttcgcttgccgcattatttgttatcttt
gataatggtttgatcacgatgagtagatacattatgattgaaattcctgcattgtatttc
atgtctttgactgcgttttactggtctgtttatgaggcacagcaaaaacgcccttttagt
cttagatggcacactagtttactctccacgggagttgctcttggtcttgctttaagtaca
aaactctctgccatgtttacgtttggttggttgttgatacttgcagcctttcacctttgg
aatttgcttggtgatcttagcgttcccatgtatcgtattgtgaaacacttgttctcgtat
attttctatttaattggtgttcctattacggtttatcttgctgtatttgctgtccattca
catattgcctataaagccagcgttgctgatgctttcttaccacccgagcacagacatgct
ttggctggcaatagatttgatgaccaatttgctgacgtggcttacggatctttggttaca
ataagaaatgccatccctgagcacgggtatttgcattctagtgaactcctttatccagaa
ggtacggagcaacaaattatatccctggtggatgaaccaaatcaaaatgctttatggatc
attgaacatgaacattctcaggacaataaccgttctaacattgaacttttaaaagacgga
agtgttgtacgcttgcgtcatgttatgactggaagggctttacactctcatgaacacaag
cccatagttagcaacaacgattggcaacttgaggcctccgcctatggtggattcggattt
gaaggggacgcaaatgatttgttccgtattcagattcttgagaagaagtctaaacatgcc
actagcaatggaacggttgagacattgaacacaaagtttagattaatccatgttttcgct
aactgtgaattaatgtcctctcatcgtcgctttccagactggggagattatcaacgtgag
gttacatgttgtcgcaactgcgtcgagcgcagtaccacgtggtttatcgaaagcaattat
catgatgggcttcccagtgattctagaaaaattacttatcgtaagcccggttttttggaa
agctttgttgagcataacaagcttatgtggttgaaggaccgaaaaatgggtgacggacat
gtttatgaaagcagcgctttaacttggccacttttgcttggtcctcttcgctttttctac
gagcagcatcttcaagtcttttttatgggtaacccatttgtttggtattcggtaatttct
ttagttgcattctttgtcatcgttcaaattttttgtttagcacgttggaatttgggctat
aacgattttgggccttctgcttttcattataattacaacattgggaaatttgttgtagca
tggttactgcattgggctccttacattttggaaactgatcgtgttttcctttaccattat
cttcctgctttgtattttggaatagctgctctaggtgtatcttggtctttccttggtaat
gcagtatttggaaatcgcactgcttacaaagcattgagtgtgataatcatggcattgatg
ttcttggtttaccgtctttacagcccatttacgtatatgacaacgttgacaaaatcatct
tgtcgtgctttagaattaaagggatcttggaacttccattgcaatacttatcttgacaat
ttatccgattacaagttttcctctgacgcgggtgaaacatatttcgaaaaagctgcacct
cacccatttgtttactccgaagacaccgcaaaaaagtcggaaggtgatactcctcttaac
aaaaatttgaatgactattatccctcttgggaccaacgggtagaggctggatataaattg
gctgcccagcaaaaagcggaacaagaggcacgcgaagctgctgagaaagccgcttctgag
gcagccgaacgctcatcatcggaagctgctgcctcaagcagttctgaaagtgttgcagct
gcttcagtggaagctgaacgcttggcaatggaagctgatgaattcaacggcgcatccgaa
actgttgatggtgcatcggtagaagctgaacgttcggcaatggaagctgctgcattgaat
aatgccgctgaatctactgaagtagtaggttcttcaccggaatctgttgctagtgagcaa
gaggaaaacgttgccgaatctgctcaagctcgtgtggagtaa

DBGET integrated database retrieval system