KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22F3.03cHelp
Entry
SPAC22F3.03c      CDS       T00076                                 

Gene name
rdh54, mug34, tid1
Definition
ATP-dependent DNA helicase Rdh54
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:spo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(703789..703967,704015..704113,704205..704280,704322..704536,704573..704763,704816..704889,704925..705056,705095..705158,705195..705293,705333..705490,705529..705601,705637..706252,706292..706361,706404..706652,706688..706828)
Genome map
AA seq 811 aa AA seqDB search
MKRRATFQCPLIESTIKHQSTNYTKTETATTSHEVSENANEHKGKSNIDINKIAYYNVVW
RKITMKKHKTWEGDGFLVREDSNLTLYNSDFTRLGSCHSRVPQIKEGELLRISGKEISIE
KEISAESYEAGTHIDDSLRDVHMPEMKRKFKPPLRPNTMYQTISALPKPRHDPTVLGALV
MSRPKTWDPRTHVDVVIDPFLSKHLYSHQREGVSFLYDCLLGMEGKCGYSAILADEMGLG
KTLQTITVVWTLLKQSYYANRSSTINNAMVVAPVTLLKNWENEFYNWLGHERIHVYIARC
AEDFQEFTSNKTYSIIITGYETVCTYLRNYGCGIDIDLLICDEAHRLKSMSSQTWITLNK
LKTRKRLLLTGTPLQNDLSEYFSMVNFIIPGSLGTPNSFKAQYERPILRSRSMNASSRDI
SLGAARLQRLFEFTSNFTLRRKANILAKHLPPRTDIVLFIKPTHQQENVYGHVLDGFKSS
VDQKGYYLKILTRLSKICNSTILLRNEKENFLSTELQDKHVFEQENMLLSSSKLQILAAL
LKSFQRGCQKAVIVSQYKETLELIELFLSILHVRFCKLLGSTPFSERDLIVHNFNTSSFK
EFSVLLLSSKAGGCGLNLTGSTRLIIYEPSWNPAQDLQALSRIYRSGQKRPVCIYTFLSS
GMLDERIFIRQNTKQGLSSSFIDSDASQKKNFFTGEDIKTLFSYSKTETCLTYELAFDSD
EIDSLTKKKDPLTKIDHTIDSPNTKEKDKEISSWKKASEYMDTNLGKKCPENAFQGWTWQ
FPNDLSIMNGVEDYIPLEPLPINCLMHKKFE
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaagagctacttttcaatgtccattaattgaatctaccataaaacatcaatct
actaattataccaaaacagaaacagcaactacctcacacgaagtatctgaaaatgcaaat
gaacataaaggaaaatcaaatatcgacataaacaaaattgcttattacaatgttgtatgg
agaaaaattactatgaagaaacataaaacatgggaaggggatggctttctcgttagagaa
gactcaaatttgactctttataattcagattttacaagactcggatcctgtcattcgagg
gtgccacaaatcaaagaaggagaattgcttcgcatttccgggaaagaaatatctattgag
aaggaaatctctgcagaaagttatgaagcaggcacacatatagatgattctctccgagac
gttcatatgcctgaaatgaagcgtaaattcaagccacctttgagacctaacacaatgtac
cagacaatatcagcactacccaaaccgaggcatgatcctactgtgcttggagctttggtg
atgagcaggcccaagacttgggatccaaggacgcatgtagatgttgttattgatcctttc
ctttcaaagcatctttattctcatcagcgggaaggagtttcctttctttacgactgttta
ttaggaatggaaggaaaatgtggatatagtgcaattttggctgatgaaatgggcttagga
aaaacgttgcaaactataacagttgtctggactttattgaagcagtcttattacgccaat
cgttcttcgactataaacaatgcaatggtcgtagcacctgtcactcttttgaagaattgg
gaaaatgagttttataattggctcggtcacgagcgtattcatgtttatatagctagatgc
gctgaagatttccaagaatttacgtcgaacaaaacttattcgattatcattacaggatat
gaaacggtttgtacgtacttgagaaactatggatgcgggattgatattgatcttctaatt
tgcgacgaagctcaccgcttgaagtccatgagtagtcagacttggattacgctgaataag
ctaaaaactagaaagaggcttcttctcactggtacgcctttacaaaacgatttgtcagaa
tatttctctatggttaactttataattcctggatctctggggaccccaaattcttttaaa
gctcagtatgagcggcctatattaaggagtagatcaatgaatgcttcctctagggacata
tcattgggagctgcaagacttcaaaggctttttgaatttacaagcaatttcacgttaagg
aggaaagccaatatactggctaaacatttaccgccaagaaccgacattgttttattcata
aaaccaacacatcaacaagagaatgtttatggacatgttctcgatggtttcaagtcaagc
gttgatcagaagggctattatcttaaaattttgactcgcttgagcaagatatgcaatagc
accattttattgagaaatgaaaaggaaaattttttgtcaacggagttgcaagataagcat
gtattcgagcaagagaatatgttgctctcctctagcaaactgcaaatattggctgcgcta
cttaaaagtttccaaaggggttgccaaaaagctgttattgtgtcccaatataaagaaact
ctcgagttgattgaattgtttttatcaattttgcatgtccgtttctgtaaattgcttgga
agtactcctttctctgagcgtgatttaatagtacacaatttcaatacttccagcttcaaa
gaatttagtgtgcttttactttcaagcaaagctggtggctgcggtttaaatcttaccgga
tccactaggttaataatttacgaaccaagttggaaccctgcccaagatttgcaagcattg
tcaaggatatatagaagcgggcaaaagcggccagtctgtatatacacatttttaagcagt
ggaatgctagatgagcgcatttttattcgccaaaatactaagcaagggctttcaagttcg
ttcatagattccgatgcaagccaaaagaagaatttttttacgggtgaagacatcaagaca
cttttttcatattcaaaaactgaaacttgcttgacatatgaattagcatttgattctgat
gaaattgattcattaacaaagaaaaaagatccgttaactaaaattgaccatacgattgat
tccccaaatacgaaggaaaaagataaagaaatcagttcttggaaaaaggcttctgaatat
atggatactaatttggggaaaaagtgtccagagaacgcatttcaaggatggacttggcaa
tttccgaatgacctaagtattatgaatggcgtagaagattatatccctcttgagccttta
cctatcaactgtctaatgcataaaaagttcgaatag

DBGET integrated database retrieval system