KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22G7.06cHelp
Entry
SPAC22G7.06c      CDS       T00076                                 

Gene name
ura1
Definition
carbamoyl-phosphate synthase (glutamine hydrolyzing), aspartate carbamoyltransferase Ura1 (EC:2.1.3.2 3.5.2.3 6.3.5.5)
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:spo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(739300..746034)
Genome map
AA seq 2244 aa AA seqDB search
MSGLLPSLSSSFPLVQSEALGMPRTHGPKPSENDPKEPTCSPSPAFYSVNGEMKDYKLMA
LELEDKSVLQGYSFGADHSVSGELVFQTGMVGYPESLTDPSYRGQILVFTFPTVGNYGVP
DRRILDEISGLPKYFESNQIHVAAIIISSYSQNYSHFLAHSSLGEWLKEQGIPGIFGIDT
RALTKKIRDQGSMLGRLLIQKDESPINPSSITGLGKDWSTAFEDIPWKNPNTENLTSQVS
IKEPKLYEPHPTTAIKKADGKIIRILVIDVGMKYNQIRCFLNRGVELLVVPWDYDFTKET
YDGLFISNGPGDPSLMDLVVDRVKRVLESKTVPVFGICFGHQIMARAAGASTTKMKFGNR
GHNIPCTCMISGRCYITSQNHGYAVDASSLSNGWKELFVNANDGSNEGIYNTEYPFFSVQ
FHPESTPGPRDTEFLFDVFIDVVKRSADAKSLQPFKLPGGTIEENRSRHPLVDAKRVLIL
GSGGLSIGQAGEFDYSGSQAIKALREEGIYTILINPNIATIQTSKGLADKVYFLPVNADF
VRKVIKQERPDSIYVTFGGQTALNVGIELKDEFEQLGVKVLGTPIDTIITTEDRELFARA
MDEINEKCAKSASASSIEEAIKVSKDISFPVIVRAAYALGGLGSGFADNEAELIDLCTLA
FATSPQVLIERSMKGWKEIEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLT
DEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFTKEYCIIEVNARLSRSSALASKATGYP
LAFTAAKLGLNIPLNEVKNSVTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLSSAMK
SVGEVMSIGRTFEEAIQKAIRAIDYSNTGFNVKDALMSIDTELQTPSDQRLFAIANAMAS
GYSVDRIWELTRIDKWFLEKLMGLIRTSQLISKHDISSLPISLLKTAKQLGFADVQIAAF
MNSTELAVRRIRTEAGIRPFVKQIDTVAAEFPAFTNYLYTTYNAVEHDIHFNDKGVMVLG
SGVYRIGSSVEFDWCAVRAVRTLRDRGVKTIMVNYNPETVSTDYDEADRLYFENIGLETV
LDIYEQESSSGIIIAMGGQTANNIALPLHRENVKILGTSPEMIDGAENRFKFSRMLDDIG
VDQPKWKELTSFDEADKFCDTVGYPVLVRPSYVLSGAAMNTVYSQSDLHSYLQQAVAINK
DHPVVISKYIENAKEIELDAVAREGKMVMHVISEHVENAGVHSGDATLVLPPQDLAPTTI
ERIVDAAAKIGEALNITGPYNIQFIAKDNEIKVIECNVRASRSFPFVSKVIGVDMISMAT
DVIMGNPIQPYPDVDLPRDYVAVKVPQFSFSRLSGADPVLGVEMASTGEVACFGHNKFEA
YLKAMISTGFRLPKKNILISIGSYKEKAELLPYVKKLYENNYNIFATAGTSDYFMESGVP
CKYLADLPAEEANNEYSLSAHLANNMIDMYINLPSNNRYRRPANYISSGYKSRRLAIDYS
VPLVTNVKCAKLMIEAICRNLDFSLSTVDFQSSFQTANLPGLINISAFLPEFTSEAVSDY
TKECIASGFTMARFLPFSTSSTLADKDSLSAVKKLALDHAHCDYNFSVIASSTNEVTISE
LTSESGCLFFHFEKDDSGIDHVTAVASHFNVWPDTQTVMTDAKSTTLASLLLLASLHNRR
IHITNVSSKDDLNLIVLAKQRSLPVTFDVSVYSLFLNQNDYPGATFLPTADDQVEIWNKL
SYIDCFSIGSIPSRLAKFVGNTAFTGFGVREAIPLLLTAVNEGRLTLKDVVDRFYSNPKA
IFRLHDQDDSGVQLEVDRSVSWSSKDWTPFNGKKLYGSIQSVQFDGHDVFFDGELNFEHT
YGRDYSSASLADKSKATRKVSALMSPGLPHAAPSLAEAFGQAPENKAHPDISLNMTPNFK
PSHELVQLINSSPFYRKHIISVHQVTRSDLHVLFAIAHQMRIIVERQGVIDLCYGKLLCT
MFFEPSTRTSSSFDAAMQRLGGKVVAVTASASSVNKGESLADTIRTLGCYGDAIVLRHPS
IESARIAANFSPVPIINGGNGSKEHPTQAFLDLYTIREELGSVNGLTITFIGDLKYGRTV
HSLARLLAFWHVELHLVSPEQLALPDDVKDDIRANGLNFIEHRELTKEVVAQSDVLYCTR
VQKERFASVDEYEKLKDSFIVDNSVLASAKSHCIVMHPLPRNREISEEVDFDQRRAAYFR
QMRYGLYIRMALLACVMGATEVAN
NT seq 6735 nt NT seq  +upstreamnt  +downstreamnt
atgtccggattgctaccttcattgtcttcatcatttccactcgtccagagtgaagctctg
gggatgccaaggactcatggtcctaaaccatctgaaaatgatcctaaagagcccacctgc
tctccatctcctgccttctactctgtgaatggcgagatgaaagattataagctaatggcc
ttggaattggaagataaaagtgttttacaaggttattcattcggagctgatcactctgtc
tccggtgaattagtttttcagactggtatggtcggttatcctgagtctttgaccgaccct
tcttatcgtggtcagattttggtctttacatttcccacagtgggtaattatggtgtgccc
gatcgtcgtattctagacgagatatctggcttacccaagtatttcgaatccaatcaaatt
catgttgctgctattattatttcatcttattctcaaaattattctcattttcttgctcat
tcttctttaggagaatggcttaaggaacagggcattcctggtatttttggtattgatacc
cgtgctcttactaaaaaaattcgcgaccaaggttctatgttaggtcgtttacttattcaa
aaagacgaatcccccatcaatccttcttcaattactggtctcggaaaagactggagtact
gcttttgaagatataccatggaaaaatcctaatactgaaaatttaacgtctcaagtttcc
attaaagaacccaaactttatgaaccccatcctactacagctatcaaaaaagcagatgga
aaaatcatccgtatccttgttattgatgttggtatgaaatataaccaaattcgttgtttt
ttgaatcgtggtgttgaattattggttgttccttgggattatgattttaccaaagagact
tatgatggtctatttattagcaatggacctggtgatccttccctcatggacttggttgtt
gatcgggtaaaacgggtgcttgagtcaaagactgtccccgttttcggtatttgttttgga
catcaaattatggctcgagctgccggcgccagtaccaccaaaatgaaatttggtaaccgt
ggccacaatatcccttgcacttgcatgatctcgggtagatgttacattacttcccaaaat
catggttatgcggttgatgcgtctagtttatcaaatggctggaaagaactttttgtcaat
gctaacgatggttcaaatgaaggtatctataatactgagtatccatttttctctgtgcaa
tttcacccagagtctactcctggtccccgcgatactgaatttctctttgatgtattcatt
gacgttgtcaagcgttcagctgatgcaaagtctttgcagccattcaagcttcctggagga
acaattgaagaaaacagatcccgtcatccacttgtggatgctaagcgtgttctgattttg
ggtagtggaggattgagtattggtcaagctggtgagtttgattattctggtagtcaagct
attaaggctcttcgtgaagaaggaatttacaccattttgattaatcccaacattgccact
attcagacatctaagggtcttgctgataaagtgtacttcttacctgttaatgctgacttt
gttcgtaaggtgatcaaacaagagcgccccgattcgatatatgttacctttggtggtcaa
acagccctgaatgttggtattgagctgaaagatgagttcgaacaactcggcgttaaagtt
ttaggtacgcctattgataccattattaccactgaggaccgtgaactttttgctcgtgca
atggatgaaattaacgagaaatgtgcaaaatcagctagtgcttcatctattgaagaagct
ataaaagtatcgaaggatatttcttttccagttattgtccgtgctgcttatgcgcttggt
ggacttggttcaggttttgctgataacgaggcggaactcattgatttatgtacgcttgct
tttgctaccagccctcaagtcttgattgaacgcagtatgaagggatggaaagaaattgag
tacgaagttgttcgcgatgcttttgataactgcattaccgtctgtaacatggaaaacttt
gatcctctcggtattcacactggtgactctattgttgttgctccatctcaaactttaacc
gatgaagattacaacatgcttcgtacgacagctgttaatgttattcgtcacctcggtgtg
gtgggtgaatgcaatattcagtatgctttgaacccttttacaaaagagtattgcatcatt
gaagttaatgctcgtttgtctcgttcatctgctttagcgtcaaaggctaccggttatcct
ctagctttcacagcagcaaaactaggtcttaacattccacttaacgaagtcaaaaactca
gtgacaaaggttacgtgcgcatgctttgaaccaagtcttgattatgttgtcgtgaagatt
ccccgttgggacttgaagaagtttactcgcgttagcactcagctgagctcagcaatgaag
tcagttggtgaagtgatgagtattggacgtacatttgaggaagcaatccaaaaggccatc
agggctatcgattatagcaatactggtttcaacgttaaggatgctttaatgtctatagat
acggaattgcaaacaccttcggaccaacgtctgtttgctattgccaacgctatggcttct
ggttattcagtggaccgtatttgggagcttactcgtatcgataagtggtttcttgaaaag
cttatgggattaattcgtacatcccaattgatttccaagcatgatatatctagtcttcct
atttctcttctaaagactgccaagcaattaggatttgcggacgtccaaattgctgctttt
atgaattctactgaattagccgttagacgtatccgtactgaagctggtatcagaccattt
gtaaaacaaattgatacagtggctgcggagttcccagctttcaccaactacctttatacc
acttataatgctgtagagcatgacatccatttcaatgataagggtgtgatggttcttggc
tcaggtgtatatcgaattggctcatcagttgagtttgactggtgcgcagttcgcgcagtt
cgtacgcttcgtgatcggggagttaaaactattatggttaattataacccagaaactgtt
tctactgattatgatgaagccgatagattgtatttcgaaaatatcggtcttgaaactgtc
ttggatatttacgagcaagaatcatcttctggtatcattatagctatgggtggtcaaacc
gctaataacatagccttgccattacatcgtgaaaatgttaaaattctcggtacttctcct
gaaatgattgatggcgccgagaatagatttaaattctctagaatgctggatgacataggt
gttgatcagcctaagtggaaggaattaactagtttcgacgaggccgataaattttgcgat
acagttggttatcctgtgttagttcgtccttcttatgttctttctggtgccgcaatgaat
acagtctattctcagtcagacctgcatagctatttgcaacaagctgttgcaattaacaaa
gatcatcctgttgttatttctaaatatattgaaaatgctaaggaaatcgaattagatgct
gttgctcgtgaaggaaagatggttatgcacgtcatttccgaacatgtagaaaacgctggt
gtgcactctggtgacgctactttggttttaccacctcaagatttggctccaacgactata
gaaagaattgttgacgccgctgctaagattggagaagctttgaatattactggtccttat
aacattcaatttattgcgaaggacaacgaaattaaagtaattgaatgcaatgttcgtgca
tcgcgttcattcccttttgtttctaaggttataggtgttgatatgatttcaatggcgaca
gatgtcattatgggtaatcctattcaaccctaccccgatgttgatcttcctcgcgattac
gttgctgtcaaagtacctcaattcagtttcagcagactgtccggtgctgaccccgtcctt
ggtgtcgaaatggcgtctactggtgaagttgcttgttttggtcacaataaatttgaagcc
tatcttaaagctatgatttccaccggctttagactcccgaaaaagaatattcttatatct
attggttcatataaagaaaaggcggagcttttaccttacgtcaagaagttgtatgaaaac
aattacaacattttcgcaacagccggtacctcagactactttatggaaagtggtgttcct
tgcaagtaccttgcagatcttcctgctgaagaagcaaataatgagtattcactttccgct
catttagccaacaacatgattgacatgtatatcaatttgccctccaacaatcgttatcgt
cgtcctgctaattatattagcagtggttataaaagtcgtcgtcttgccattgattattca
gtccctttggttacaaatgtcaaatgtgcaaagcttatgattgaggcaatttgcagaaac
ttggatttcagcttgagtacagtagatttccagagcagtttccaaactgctaatctacca
ggtttgattaacatatctgctttccttcctgaatttacttctgaagccgtttctgactat
acaaaagaatgtattgcatctggttttactatggctcgatttttaccatttagtacgtct
tctactttagcagacaaggattcgttgtctgctgttaaaaagttagctttagaccatgct
cattgcgattacaacttttcagtcattgcctcctcaactaatgaagttactatctctgaa
ctcacatctgaatctggctgtttgtttttccattttgagaaagacgattctggtatcgat
catgttactgcagttgcctctcattttaacgtatggcctgatacgcagactgtgatgaca
gatgccaaatcgacaactttagcttcgttattgttattggcaagtcttcataaccgtagg
attcatattacaaatgtatcttctaaggacgatttgaatttgattgtacttgctaagcaa
agaagtcttcctgtcacatttgatgtttcagtttatagtcttttcttgaaccaaaatgat
tatcccggagcgacatttttacctactgctgatgatcaggttgagatatggaataagctc
tcatacattgattgtttttctattggtagtattccttctcgtcttgctaagttcgtgggt
aatacggcttttactggctttggagttcgcgaggcaattccacttttgttaacagctgtt
aatgaaggtagacttactttaaaggatgttgttgatcgcttctattcgaaccctaaagcc
attttccgtttgcatgatcaagacgattctggcgttcaattggaagttgatcgttctgtt
agctggtcttccaaagactggacccctttcaatggcaagaaactttatggtagcatccaa
tctgttcagtttgacggtcatgatgtattctttgatggtgaactgaatttcgaacatact
tatggtcgtgactattcttcggctagtttggctgacaaatctaaggcaactagaaaggtt
agtgcgttgatgagtcctggtcttccccatgctgccccttctcttgccgaagcattcggt
caagcaccagagaacaaagcgcatcctgatattagcttgaacatgactcctaatttcaag
ccttctcatgaactggtacaattgatcaactcttcgcccttctatcgcaagcatatcatt
tcggtgcaccaagttactcgttctgatttgcatgtactatttgctattgctcatcaaatg
agaatcatagttgaaagacaaggtgtgattgacttgtgctatggaaaacttctttgtact
atgttctttgaaccatcaactcgtacttcatcgtcttttgatgctgcaatgcaacgttta
ggaggaaaagtagtcgctgttacagctagtgcttctagtgtcaataaaggtgagagcttg
gctgataccattcgtacacttggatgttatggtgatgctattgtcttgcgccatccttca
attgaaagcgcacgcattgctgctaacttttctcccgttcctatcatcaatggtggtaat
ggctcgaaggagcatcccacacaagctttcttggatctttataccattcgtgaagagtta
ggtagtgtcaatggacttacaattacgtttattggtgatcttaaatacggacgtaccgtt
cattcattagctcgtttgcttgcgttttggcatgtcgaattgcatcttgtatcacctgaa
caattggcacttcctgacgacgtgaaagacgatattcgtgcgaatggattgaatttcatt
gagcaccgtgagttgactaaagaagttgttgcacaatctgatgtactttactgtaccaga
gtacagaaagaacgttttgctagtgttgatgaatatgagaaattaaaggattcttttatc
gttgacaacagtgttctagcctctgccaaatcccactgtatcgttatgcatcctttgcct
cgtaatcgtgaaatcagtgaagaggttgattttgatcaaagacgtgctgcttacttccga
caaatgcgttatggtctctatattcgtatggctttactcgcttgtgttatgggtgctact
gaagtagcaaattaa

DBGET integrated database retrieval system