KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22H10.05cHelp
Entry
SPAC22H10.05c     CDS       T00076                                 

Definition
mRNA cleavage and polyadenylation specificity factor complex subunit (predicted)
Orthology
K14399  
polyribonucleotide 5'-hydroxyl-kinase [EC:2.7.1.78]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:spo03015]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(2378728..2380026,2380172..2380243))
Genome map
AA seq 456 aa AA seqDB search
MKEIFIPKECEWRFEVDEPAIQIRLVSGNAEYFGTELALGPPYHFTRVKGAIYTWQGCTL
EVEGEPSVEYVAEETPMSTYLNLHFALEGLRLQAENAAANDESSYGPCVCLIGPRSCGKT
SVLKILESYALKQSRHPICVNLDPTQPMLALPGSISAFHNATILDIQDADGFGASTSTGP
THVLAKVPLVYNFGLDSPLDNPKLYKLSLSRLALAVHSRMSQSKDARVSGCLVDTSSIQE
NAEKYQDILHSIITDFRINIIIVLGSERLYSSMKRKYADATWLSVVKVSSSGGCIDREEE
WIQQFQARCIKQYFYGDDRMPLSPLSMIVDSTQLVVYRVLEASESGPKSSVLPLGFEEEN
TQSEKQDGNTSLRLHGKGEFLERISTEAMTILQNSILAVSSVGEDEDEATVVDSCIIGYV
FVSDVDDVKNRMTLLSPVPEQLPSNALIMGTCKWQE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaattttcattccgaaagagtgtgaatggagatttgaggtcgacgaaccggca
attcaaattcgactcgtgtctggaaatgcagaatattttggcactgaattggctttaggt
ccaccatatcattttactcgtgttaaaggagcgatatatacatggcagggatgtacttta
gaagttgaaggtgaaccgtccgttgagtatgttgctgaagaaactcctatgagtacatat
ctaaatttgcattttgctttggaaggccttagattacaagccgaaaatgccgctgcaaat
gatgagtcttcatatggaccgtgtgtttgcctcattggcccaagaagttgtggtaaaaca
agtgtcttgaagattttagaatcatacgctttgaaacaatctcgacatccaatttgtgtt
aaccttgatcctactcaaccaatgttggctctccctgggtctatttctgcatttcacaat
gccactattcttgacattcaggatgctgatggctttggtgcaagcacatctactggtcct
actcacgttcttgccaaagtaccactggtatataactttggtttggattcaccacttgat
aatcctaagctttataagctttcattatctaggctagctttggcggtgcattctagaatg
tcccaaagtaaagatgcccgagtgtctggttgtttggtagatacttcatccattcaagaa
aatgctgagaagtatcaggatatccttcattctataattacagacttccgcattaacatt
attattgtacttggttcagagagattgtacagcagtatgaaacgtaagtatgctgatgcg
acctggttgtctgtggtgaaagtttcatcaagtggtggttgtattgatcgcgaagaagaa
tggattcaacaatttcaggctcgttgcattaagcaatacttttatggtgatgatcggatg
cctctttctcctttgtctatgatagttgattccacccaactggtagtgtatcgtgttttg
gaggcgtctgaaagcggacctaagtcttctgtccttcctttagggtttgaagaagaaaat
actcaatctgaaaagcaagatggaaatacatctttaagattacatggcaagggcgaattt
ttggagcgaattagtactgaagcaatgaccattttacaaaactccattttagcagtttca
agtgtcggcgaagatgaagatgaagcaacagttgttgactcatgtatcataggatatgtg
tttgtttcggacgttgatgatgttaaaaacagaatgactcttttgtctccagttcctgaa
caacttcccagcaatgctttaataatgggaacttgcaaatggcaggagtaa

DBGET integrated database retrieval system