KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23G3.08cHelp
Entry
SPAC23G3.08c      CDS       T00076                                 

Gene name
ubp7
Definition
ubiquitin C-terminal hydrolase Ubp7
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(881023..883650)
Genome map
AA seq 875 aa AA seqDB search
MPHSNTLIVPSTNPFDDPSSIKNGLNNLTSSELVNQMKKESLAASVKTPSTPPKECSHLK
KGVKLSHLKGNARALRDPSKHLCFICTTEKIKREDYELTLCANCGYLFCCNHESDHSRKH
FEKNKKHCVFVNIITLKCHCYSCDADIVIFDKKNLVVRDVQQFICSNLVSSLTKAPNVLK
SNSSHFKKEKKSKHSSGKSSKKYKVISPGLKNLGATCFFNSTLQVLCACEALHDVISPFQ
YSHSSVIVRKLTKSPESSLLSAFIKFLETFYKSDGTISVYRPTTFFGEFRRLHPQFSESV
QQDAHELLRLLLDDLISEEFRVLRFNLNSVSRSLQLSPCLTDDEQLSKSLTSFKQVNVTD
ASLSPNSHNTSDNEQNNEDYVSVSSLVGSETEDITYSKELSQSSDSSQHQHDSFLPANSS
PLAASSTKSLPSSELLDSSSDKGQQVFKGQHEVAGTNSFEDPNSHFNVSNSSNHEEASPK
KEVLKSPQFQRRSLDILRLGELSSDDMMLDKATMDEFSSSLVIKSIFTGRLTSVVMCQSC
NEITNTPEPIQDLSIPIHYPSSRVSRRHRFHRALRSRFSRSPKKSSVKIVVDNANDDTDQ
APTTNSSSLNENLLGGHASENDKSLKQSPFQKLTRRLSDLSVNSSGQISKQDFDNSNSIF
SESSLSSPIIEEPKTLIDCLKNFTHVEELSGENMFACENCCNQPNEVGSPAKGGLTSDND
KYSFNNSVYRNAYKRMLLDDPLPPVFIIHLKRFFQEISHDGYANPKKISDFIEFEQELDL
NEFVMPHLRASSSFRYRLFGVIVHSGTLNYGHYVAYVLSHKFLDLSAPSTNSKDFRSEAG
IPERRWLYISDNIVRESSWDEVSKVEAYMLFYERV
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgcctcattctaacactttaattgtgccatccacaaacccatttgatgatccatcatcc
ataaagaatgggcttaacaatctgacaagtagtgaattagttaaccaaatgaaaaaggaa
tcattagctgctagtgttaaaaccccttcaacaccacccaaagaatgttctcatttgaaa
aaaggtgttaagctgtctcatctcaaaggtaatgctcgtgctcttcgggatccgagcaaa
catttgtgctttatatgcaccacggagaaaataaaaagggaggattatgaactaacactt
tgtgctaattgtggctaccttttctgctgcaatcatgagtctgatcatagccgaaaacat
tttgaaaagaataagaagcattgcgtttttgtcaacattataaccttgaaatgtcactgt
tacagttgtgatgcagatatagttatttttgataaaaagaatttagttgtgcgggacgtt
caacaatttatttgctctaacttggtttcatcgttaactaaggcccccaacgttttaaaa
tccaattcgtcacactttaaaaaggaaaaaaagagtaagcattcttctggcaaaagctcg
aagaaatataaagttatcagtcctggtttaaaaaatttgggtgccacatgcttttttaat
tcgactttacaagtcctatgtgcttgtgaggctttacacgatgtgattagcccgttccaa
tattcccactcctcagttatagtgcgaaagttaacgaaatctcctgaatcttctctttta
tctgcattcattaaatttttggagaccttttataaatcagatggcactatctccgtatat
cgtcctaccacttttttcggagaatttcgaagactacatccccagttttccgaaagcgtc
cagcaggatgctcacgagcttttaaggctgttattggacgatctcatttctgaagaattt
cgtgtactgagatttaaccttaatagtgtatcacgttctcttcaacttagtccatgtttg
acagatgatgaacagctttctaaatcgttaacttcgtttaaacaagtgaatgttacagat
gcttctttgtcgccaaattcacacaatacaagtgataacgagcagaacaacgaagattat
gttagcgtttcttcattagtgggttctgagaccgaagatattacttattcgaaggagttg
tcgcaatcatctgactcttcacagcatcagcatgacagtttcttgcctgctaattcatcg
ccattagcggcctcgtctacaaaatcccttccatcgtcagaacttctcgattccagttca
gacaagggacaacaagtttttaagggtcaacatgaggtcgctggtaccaattcttttgaa
gatcctaattctcatttcaatgtatctaatagttctaatcatgaggaggctagtcctaaa
aaagaagttttaaaatctcctcaatttcaaaggcgttcactagacatactacggcttggt
gaactttcttcagatgatatgatgcttgataaagctactatggatgaattttcttcaagc
ctggtgatcaagtcaatttttacaggccgtttaacgagcgttgtgatgtgccaaagttgt
aatgaaattactaacactcctgaacctattcaagatttatccatacctattcattacccg
tctagccgcgtaagtcgtcgtcatcgattccatcgtgctctccgttcacgatttagtcgt
tcaccaaaaaaatcgtctgtaaagatagttgttgacaatgctaacgacgacactgatcaa
gccccgactactaattcctcttcgttaaatgaaaatttacttggtgggcatgctagtgaa
aatgacaagagtttgaaacagtctccatttcaaaaactgactcgaagattaagtgatctc
tctgtcaattctagcgggcaaatttcgaaacaagattttgataatagtaattcaattttc
tcagaatcttcactatcaagcccaataatagaggagcctaagacacttattgattgtctc
aaaaactttactcatgttgaggagttaagtggtgaaaacatgtttgcctgcgagaattgc
tgtaatcaacctaacgaagttggctctccagctaagggaggattgacgtcggataacgat
aaatattcgtttaataacagtgtttatagaaatgcttacaagcggatgttattagatgac
cctttacctcctgtttttattatccatttgaagcgttttttccaggagatttcccacgat
ggttacgccaatcccaaaaaaatttccgatttcattgagtttgaacaagaattagattta
aacgagttcgttatgccacacctacgtgcttcaagtagttttagatatcgacttttcggg
gtcattgtgcacagtggcaccctgaattatggtcattatgttgcttacgtattgtctcat
aaattcttagacctcagtgccccttctacgaattctaaggatttccgttctgaagctggc
atacccgagagacgatggctttacattagtgacaatattgtacgcgaatcatcctgggac
gaggtttcaaaagtcgaagcgtatatgctattctatgaacgtgtttag

DBGET integrated database retrieval system