KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23H4.18cHelp
Entry
SPAC23H4.18c      CDS       T00076                                 

Gene name
rbx1, pip1
Definition
RING-box protein 1
Orthology
K03868  
RING-box protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Nucleotide excision repair
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-BTRC complex
Cul4-DDB1-CSA complex
SCF-CDC4 complex
SCF-GRR1 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:spo04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:spo03420]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1575410..1575484,1575673..1575822,1575886..1575976,1576021..1576028)
Genome map
AA seq 107 aa AA seqDB search
MEDEMQIDKKEVEIEQKPPRFEIKKWNAVALWQWDIVVDNCAICRNHIMDLCIECQANTD
SAAAQECTVAWGTCNHAFHFHCISRWLNTRNVCPLDNREWEFQRYGH
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgaaatgcaaatagacaagaaggaggtggaaattgaacaaaaacctcctcga
tttgaaattaaaaagtggaatgctgtagcattatggcaatgggacattgttgtagataac
tgtgctatctgcagaaatcatattatggacttatgtattgagtgtcaagctaacaccgat
tctgctgctgctcaagagtgcacagtggcatggggaacttgtaatcatgcatttcacttt
cactgcatctcaagatggttaaacactaggaatgtttgtcctttggacaatcgtgaatgg
gagttccaacgttatggtcattaa

DBGET integrated database retrieval system