KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23H4.18cHelp
Entry
SPAC23H4.18c      CDS       T00076                                 

Gene name
rbx1, pip1
Definition
RING-box protein 1
Orthology
K03868  
RING-box protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Nucleotide excision repair
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-BTRC complex
Cul4-DDB1-CSA complex
SCF-CDC4 complex
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC23H4.18c (rbx1)
   04120 Ubiquitin mediated proteolysis
    SPAC23H4.18c (rbx1)
  Replication and repair
   03420 Nucleotide excision repair
    SPAC23H4.18c (rbx1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC23H4.18c (rbx1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     SPAC23H4.18c (rbx1)
   ECV complex
     SPAC23H4.18c (rbx1)
   Cul3 complex
     SPAC23H4.18c (rbx1)
   Cul4 complex
     SPAC23H4.18c (rbx1)
   Cul7 complex
     SPAC23H4.18c (rbx1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      SPAC23H4.18c (rbx1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      SPAC23H4.18c (rbx1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1575410..1575484,1575673..1575822,1575886..1575976,1576021..1576028)
Genome map
AA seq 107 aa AA seqDB search
MEDEMQIDKKEVEIEQKPPRFEIKKWNAVALWQWDIVVDNCAICRNHIMDLCIECQANTD
SAAAQECTVAWGTCNHAFHFHCISRWLNTRNVCPLDNREWEFQRYGH
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgaaatgcaaatagacaagaaggaggtggaaattgaacaaaaacctcctcga
tttgaaattaaaaagtggaatgctgtagcattatggcaatgggacattgttgtagataac
tgtgctatctgcagaaatcatattatggacttatgtattgagtgtcaagctaacaccgat
tctgctgctgctcaagagtgcacagtggcatggggaacttgtaatcatgcatttcacttt
cactgcatctcaagatggttaaacactaggaatgtttgtcctttggacaatcgtgaatgg
gagttccaacgttatggtcattaa

DBGET integrated database retrieval system