KEGG   Schizosaccharomyces pombe (fission yeast): SPAC24B11.06cHelp
Entry
SPAC24B11.06c     CDS       T00076                                 

Gene name
sty1, phh1, spc1
Definition
MAP kinase Sty1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SPAC24B11.06c (sty1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SPAC24B11.06c (sty1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SPAC24B11.06c (sty1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(206864..207913)
Genome map
AA seq 349 aa AA seqDB search
MAEFIRTQIFGTCFEITTRYSDLQPIGMGAFGLVCSAKDQLTGMNVAVKKIMKPFSTPVL
AKRTYRELKLLKHLRHENIISLSDIFISPFEDIYFVTELLGTDLHRLLTSRPLETQFIQY
FLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRDHVNQFSIITELLGTPPMEVIET
ICSKNTLRFVQSLPQKEKVPFAEKFKNADPDAIDLLEKMLVFDPRKRISAADALAHNYLA
PYHDPTDEPVADEVFDWSFQDNDLPVETWKVMMYSEVLSFHNMDNELQS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatttattcgtacacaaatattcggtacatgttttgaaattaccactagatat
agcgacttacagccgattggcatgggcgcctttggcctcgtttgttcagcgaaggatcag
ctaactggaatgaatgtcgctgttaagaaaattatgaaaccctttagtactccggtactg
gcaaaacgtacctatcgggaattaaaactattaaagcatttaaggcatgagaatattatt
agcttgagcgatatttttatttctccctttgaagatatttattttgtcacggagcttctg
ggaacagatcttcatagactacttacatcgcgacctttagagacgcaatttatacaatac
ttcttataccaaatcttgcgagggctcaagtttgttcattctgccggtgttattcaccgt
gatctgaaacccagtaacatcttaattaacgaaaattgcgatttaaaaatctgcgatttc
ggtttggctcgtattcaagaccctcaaatgacgggctatgtttctactcgttattaccgt
gcacctgagattatgttaacttggcaaaagtacaacgtcgaagttgatatttggagtgcg
ggttgtatttttgctgagatgattgaaggaaaacccttgtttcccggccgagaccacgtt
aaccagttttctataatcacggaattgttgggaacgccgcctatggaagtaattgagacg
atttgcagtaaaaacacacttcgctttgttcaatcattgcctcaaaaggagaaagttcct
tttgctgaaaagttcaaaaacgccgatccagatgctattgatctgttagaaaaaatgctt
gtctttgatcctcgtaagcgtattagtgctgctgatgctttggctcataactatcttgct
ccataccatgatcctactgatgagcctgttgctgatgaagtttttgactggtcattccaa
gataatgatttacctgtggagacttggaaggtcatgatgtactccgaggttttgtcgttt
cacaacatggataatgaactgcaatcctaa

DBGET integrated database retrieval system