KEGG   Schizosaccharomyces pombe (fission yeast): SPAC24H6.03Help
Entry
SPAC24H6.03       CDS       T00076                                 

Gene name
cul3, pcu3
Definition
cullin 3
Orthology
K03869  
cullin 3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC24H6.03 (cul3)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     SPAC24H6.03 (cul3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(485960..486131,486188..486597,486649..486822,486867..486931,486984..487093,487133..488517,488574..488615))
Genome map
AA seq 785 aa AA seqDB search
MQRSAKLKIRAPRKFSANQVDFATHWEVLQRAIGDIFQKSTSQLSFEELYRNAYILVLHK
YGEKLYNHVQDVIRSRLKEETVPAIYKNYDASLLGNALLDIRKNDSYSTSWSRSLEAAHR
FLSSLVNSWKDHIVSMQMISSVLKYLDKVYSKSADKVPVNENGIYIFREVVLLNSFEIGE
KCVETILILVYLERKGNTINRPLINDCLDMLNSLPSENKKETLYDVLFAPKFLSYTRNFY
EIESSTVIGVFGVVEYLKKAEKRFEEEKERSKNYLFTKIASPLLSVVEDELLSKHLDDLL
ENQSTGFFSMIDSSNFEGLQLVYESFSRVELGVKSLKKYLAKYVAHHGKLINETTSQALE
GKMAVGRLSSNATMATLWVQKVLALWDRLNTIISTTMDADRSILNSLSDAFVTFVDGYTR
APEYISLFIDDNLKKDARKAIEGSIEATLQNSVTLFRFISEKDVFEKYYKTHLAKRLLNN
RSISSDAELGMISRLKQEAGNVFTQKLEGMFNDMNLSQELLQEYKHNSALQSAKPALDLN
VSILASTFWPIDLSPHKIKCNFPKVLLAQIDQFTDFYLSKHTGRKLLWYPSMGSADVRVN
FKDRKYDLNVSTIASVILLLFQDLKENQCLIFEEILEKTNIEVGDLKRNLQSLACAKYKI
LLKDPKGREVNAGDKFYFNENFVSNLARIKISTVAQTRVEDDSERKRTLEKVDESRKHQA
DACIVRVMKDRKVCEHNQLMAEVTRQLNPRFHPSPMMIKRRIEALIEREYLQRQADNGRI
YEYLA
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggtcagcgaagttaaaaattcgagcgccacgaaaattttctgctaaccaagta
gactttgctacacattgggaagtcttgcagcgagctattggggatatatttcagaaaagc
acatctcaattatcgtttgaagagttgtatagaaatgcatatatacttgttctacataag
tatggagaaaagctttataatcatgtacaggatgttattagatcgaggcttaaagaagaa
actgttccagctatttacaaaaactatgacgcttccttattagggaatgctctattggat
attagaaaaaatgattcctattctacttcatggtcgagatcattggaagcggctcataga
tttttatcgtctttagttaattcctggaaggatcacattgtttcaatgcaaatgatatct
agtgtattaaaatatttggacaaggtttattcaaaatctgcagacaaagttcctgttaat
gaaaacggaatatatatctttcgtgaagttgttttgttaaatagttttgaaattggagag
aaatgtgtcgaaactattctaattctggtttatcttgaacgtaaagggaatacaataaat
cgacccttaataaatgactgcttagatatgctaaactctttgccttcagaaaacaaaaag
gaaactctttatgatgttttatttgctccaaagtttttatcttacacaagaaatttctat
gaaatagaatcatcaacagtcatcggcgtatttggagttgtggagtatctgaaaaaagca
gagaaaagatttgaggaagaaaaggagaggtccaagaattacctgttcacaaaaatagct
agcccccttctatccgttgttgaagatgagcttttgagtaaacatttggacgatttgctt
gaaaatcaatcaactggctttttctcgatgatcgactcttcaaacttcgagggtcttcaa
ttggtttacgaaagcttttctagagtggaacttggcgtgaagtctttaaaaaaatacttg
gcgaaatatgtagcgcatcatggaaaattaatcaatgaaactactagccaagcgcttgaa
ggaaagatggctgttggtcgtctatcatctaatgctacaatggcaacattatgggttcaa
aaagttttggccttatgggatagactaaatacaattataagtactactatggatgctgat
cggtctatcttgaactctttatcagatgcttttgttacgttcgtagacggatatacccga
gcccccgagtacatttcactattcattgatgacaatctgaaaaaagatgctagaaaagca
atagaaggctctattgaagcaacacttcaaaattctgttacgttatttcggtttatttca
gaaaaagatgtttttgaaaaatattacaaaacacaccttgcaaaaaggttgttgaataat
cgatcaatatcttccgatgcagagctcggaatgatcagtaggctgaaacaagaagctggt
aatgtttttactcaaaagctcgaaggaatgtttaatgatatgaatctttcacaagaattg
ttacaggagtacaaacataattctgcgttacagtcggccaagcctgctttggacttaaac
gtttcaattttggcttctacattttggcccatcgatttatcgcctcacaaaattaaatgt
aactttccgaaagttctcctggctcagatagatcaatttacggatttttatttatcgaaa
catacggggagaaaattattgtggtatccttctatgggaagtgctgatgtccgtgttaat
ttcaaagacagaaaatatgacttgaatgtatcgactattgcatctgttattctattgctt
ttccaagacctaaaagaaaatcagtgtttaatttttgaggagattttggaaaaaaccaat
atagaagttggggatttgaagcgcaatcttcagtcccttgcttgtgcaaaatacaagatt
ttgctaaaggatccaaaaggaagggaggtgaatgcaggtgacaagttttatttcaatgag
aactttgtttcaaatctcgcccggattaaaatatcgacagttgctcagactcgtgttgag
gatgatagtgagagaaaacgtacattagagaaggtagacgagtcaaggaagcatcaagca
gatgcctgtattgttagagtgatgaaggatcgcaaagtgtgcgaacacaatcagctgatg
gcagaggttacaagacagttaaaccctcgtttccaccctagtccgatgatgattaagcga
cgaattgaagctttaatagagcgggagtacctacaaagacaagccgataatggtcgcatt
tatgaatatttagcatag

DBGET integrated database retrieval system