KEGG   Schizosaccharomyces pombe (fission yeast): SPAC24H6.12cHelp
Entry
SPAC24H6.12c      CDS       T00076                                 

Gene name
uba3
Definition
NEDD8 activating enzyme
Orthology
K10686  
ubiquitin-activating enzyme E1 C [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC24H6.12c (uba3)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPAC24H6.12c (uba3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:461939..463273
Genome map
AA seq 444 aa AA seqDB search
MPSSDVCKAGSHRHSGWIQSLKKPGPFNLDAPENPEETLKSAFSSKILIIGAGGLGCEIL
KDLALSGFRDLSVIDMDTIDITNLNRQFLFNESNIDEPKANVAASMIMKRIPSTVVTPFY
GKIQDKTIEFYKEFKLIICGLDSVEARRWINSTLVAIAKTGDLIPLVDGGSEGLKGQARV
IIPTITSCYECSLDMLTPKISYPICTLANTPRLPEHCVEWAYLLEWPRVFLNASVDSFSK
QEVFEPLDGKNSNFEPDNIRHIDWLVKRSIERANKFQIPSSSINRFFVQGIVKRIIPAVA
STNAIIAASCCNEALKILTESNPFLDNYMMYVGEDGAYTYTFNLEKRSDCPVCGVLSEVY
DISASSTVTLKDILNHYSKSYNLQNPSVSTAAGTPLYLASPPALQVATSKNLSQPILSIT
SVDVNLVITDKNLSTSLSVQLREC
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctcagacgtatgtaaagctggtagtcacaggcattctggatggatccaaagt
ctcaaaaaaccagggcctttcaacttggatgctccagaaaaccctgaagaaactcttaag
tctgccttttcttctaaaatcttaattattggtgctggtggtctaggatgcgagatttta
aaggatttagcattatctggatttcgagatttaagcgtaatcgacatggatactattgac
attacaaatttgaatcgacaatttctatttaatgaaagcaacattgatgagccgaaagcc
aacgttgccgcatcaatgattatgaaacgaatcccttctacggtagtaacacctttttat
gggaaaattcaagacaaaacaattgaattctataaggagtttaaacttattatatgtggc
cttgattcagtagaagctcgacggtggatcaattcaactctcgtggccattgctaagaca
ggagatcttataccgttggtcgatggcggctcagagggccttaagggtcaagcccgagta
atcattccaacgataacaagttgctatgaatgttcattagacatgcttacgcctaagatt
tcgtatcccatatgtacattggcgaatactcctcgattgccggagcattgcgtcgaatgg
gcatatttactcgaatggcctcgagtttttcttaatgcttcagttgatagtttttctaag
caagaagtttttgaaccgctggatggaaaaaattccaattttgaaccagataatatccga
catattgactggctcgtaaaacgttctatcgaacgtgccaataaatttcaaataccctct
tcctcaatcaatcgttttttcgtgcaaggaatcgtaaagcgtatcataccagcggttgcg
tcgacaaatgccataattgccgcgagctgttgtaacgaagcattaaaaattttgacggaa
agcaatccgtttttggataattacatgatgtatgtcggtgaagatggagcgtatacatat
acatttaatttggaaaagagatcagattgtcctgtttgcggcgtattgtctgaagtctat
gatatttcagcctcatctaccgttactttaaaggatattttaaatcattattctaaatct
tataatctacaaaatccttcggtttcaacagctgcaggaacccctctgtacttggcttca
cctccagctcttcaagttgcgacatctaaaaatttatctcaacctatattaagtattacg
tcggttgatgtgaaccttgtaattactgataaaaatctttctacaagtttgtctgttcag
ttgagagaatgctag

DBGET integrated database retrieval system