KEGG   Schizosaccharomyces pombe (fission yeast): SPAC25G10.08Help
Entry
SPAC25G10.08      CDS       T00076                                 

Definition
translation initiation factor eIF3b (p84)
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPAC25G10.08
Translation factors [BR:spo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SPAC25G10.08
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:4310579..4312756
Genome map
AA seq 725 aa AA seqDB search
MSEILIEEIKDQIVVKDEEIDVSELEVKLNVTKPVGYDTVVVIEGAPVVEEAKQQDFFRF
LSSKVLAKIGKVKENGFYMPFEEKNGKKMSLGLVFADFENVDGADLCVQELDGKQILKNH
TFVVRKLNQLEKAFSTPDEFSFEEREFKEREHLRSWLTDYYGRDQFISYYGNRVSVNWNR
KSDVPEQIVDRENWTETYVQWSPMGTYLVSLHLRGIQLWGGESWGMCARFLHPYVKFVDF
SPNEKYLVSWSYEPVRLPPIGHPARETMPFTDDDEGKHCFVWDIASGRILRSFKIPPQPE
GSKDGKKVIWPIFKWSADDKYLARVTVGQSISVYETPSLALVDKKTIKIDGVQNFEWCPV
SDALGRDSKEQLLAYWTPEITNQPARVALISIPSKSTIRTKNLFNVSDCKLYWQSNGDYL
CVKVDRHTKTKKSTFSNLEIFRIREKNIPVEVVDLKDVVLNFAWEPKSDRFAIISANDQV
LNSTNVKTNLSFYGFEQKKNTPSTFRHIITFDKKTCNSLFMAPKGRFMVAATLGSSTQYD
LEFYDLDFDTEKKEPDALANVQQIGSAEHFGMTELEWDPSGRYVTTSSTIWRHKLENGYR
LCDFRGTLLREEMIGEFKQFIWRPRPPSPLTKEDMKKIRKKLKDYNRLFDEEDIAEQSSA
NRELAARRRQLISEWQKYRDEVIARVAEERAITGQPAITVPAEEEEIIQETVEEVISEEI
EPVED
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaatcctaattgaggaaattaaggatcaaatcgtcgtaaaggacgaggaaatc
gatgtttctgaactggaagttaagcttaatgtaactaaacctgttggatatgacacggtt
gtagtaatcgaaggtgctccagttgtcgaagaagctaagcagcaagatttcttccgtttt
ttgagctcaaaagtccttgctaaaattggaaaggttaaggaaaatggattttatatgcca
tttgaggaaaaaaatggaaaaaagatgtctcttggactagttttcgccgattttgaaaat
gttgatggcgccgatctttgcgttcaagagttggatggaaagcaaattttaaaaaaccat
actttcgttgttcgtaagttgaatcaactcgaaaaagcttttagcactcctgatgaattt
agtttcgaagaacgtgaatttaaggagcgcgaacatttgcgtagctggttaactgattac
tatggtcgtgatcaatttatcagctattacggtaaccgtgtatctgttaactggaaccgt
aagagcgacgtccctgaacagattgtggatcgtgaaaactggaccgagacctacgtgcaa
tggtctcccatgggcacttacctcgtatcacttcatcttcgtggtattcaattatggggt
ggggaatcttggggaatgtgtgctcgtttcttgcacccctacgtaaaatttgtcgacttc
agccctaacgagaagtatcttgtttcatggtcctatgagcctgttcgacttcctcccatc
ggacatccggctcgtgaaacaatgcctttcactgatgatgatgaaggaaaacattgcttc
gtttgggatattgcctctggtcgtattcttcgttcttttaagattcctcctcaaccagaa
ggttcaaaggatggcaaaaaagttatttggcctattttcaagtggtctgccgatgataaa
taccttgctcgcgttactgttggtcagtcgatttctgtttatgagacaccctcccttgct
ttggttgacaagaaaactatcaagatcgacggtgtgcaaaattttgaatggtgcccagtt
tcagatgctctcggacgtgattccaaggagcagcttttagcttactggacccctgaaatt
accaatcaacctgctcgcgttgccttaattagtattccttcaaaatcaactatccgtacg
aaaaatcttttcaatgtttccgactgtaagttgtactggcagtctaatggtgattattta
tgtgttaaggttgatcgtcacacaaaaactaagaaatcaacattctctaaccttgaaata
ttccgaattcgtgagaaaaatattcccgttgaagtagtggatcttaaggatgttgttctc
aattttgcctgggaacctaagagtgatcgttttgccataatttcagctaatgatcaagtt
ttaaattctacaaatgtaaaaactaatttatcgttttatggttttgagcagaaaaagaac
acccctagtactttccgtcatatcattacttttgataagaaaacatgcaattcacttttt
atggcgcctaagggtagatttatggttgctgcaacccttggttcctctactcaatatgat
ttggagttttacgacttagattttgataccgaaaagaaagaaccggatgctcttgccaat
gttcagcaaataggttctgccgagcactttggtatgactgagctggagtgggatcctagt
ggtcgatatgttactactagcagtactatttggaggcataagcttgagaacggttacaga
ctttgcgattttaggggcacacttcttcgtgaagaaatgattggagaatttaagcagttt
atctggcgtccgagacctccttctccattgacaaaggaagacatgaagaaaattagaaag
aaacttaaggattataatcgtttgtttgatgaagaggatatcgccgaacagagttccgcc
aatcgtgaattggcagcccgtagaagacagctcattagtgagtggcagaaatatagggat
gaggttattgctcgggttgcggaagaacgtgcaatcactggccaacctgctatcactgtt
cctgctgaagaagaagaaataattcaggaaacggttgaggaagtaatctctgaagagata
gaacccgttgaagattaa

DBGET integrated database retrieval system