KEGG   Schizosaccharomyces pombe (fission yeast): SPAC26A3.05Help
Entry
SPAC26A3.05       CDS       T00076                                 

Gene name
chc1
Definition
clathrin heavy chain Chc1 (predicted)
Orthology
K04646  
clathrin heavy chain
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SPAC26A3.05 (chc1)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPAC26A3.05 (chc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(3339136..3339177,3339218..3339291,3339348..3344232)
Genome map
AA seq 1666 aa AA seqDB search
MAQQLPIRFSEVLQLASVGIQPSSFGFANVTLESDKYVCVRDNPNGVNQVVIVDLEDPSN
VLRRPISADSVILHPKKKIIALKAQRQLQVFDLEAKAKINSYVMNQDVVYWTWISDSVIG
MVTDTSVFHWTVSGSDPVKMFDRHSSLNGTQIISYKSNYNEEWFTLIGISSRDNRIAGNL
QLYSKKRKVSQPLESHASAFAVIQPEGVDHEVQVLALASRLPTGSKLSIVEVDRNPNNPA
FATKTVDLFFPPEAVNDFPIAIEIGSTYNVAYVVTKYGFIHVYDLETAKCIYMNRVSGES
IFVTTAHKSVNGLMAINRKGQVLSVSINPETIIPYILSNLNDPGLAVRMASHANLPGADN
LYMQQFQQLMAQGNYSEAAKVAASSPRGILRTSQVIDQFKLIQAAPGQIAPILQYFGTLL
DKGPLNEHETIELARPVLAQNRIQLLEKWYGENKLACTEALGDLVKPYNTPFALKIYETA
NVPNKVVMCLSELGDFGKLATYTSQQNITPDYVSLLQNLVRVNPDQAAEFATQMFNSNPS
INLEKIVDIFMSQNLVQQATAFLLDALKDDNPEHSHLQTRLLEINLINAPQVADAILGNQ
MFTHFDRAVIASLCERAGLVQRALELYDKPADIKRVIVHSNLLNPEWLMNYFSRFSPDEV
YDYLREMLRSNLRQNLQIVVQIATRYSDLVGAQRIIEMFEKFKTFEGLYYYLGSIVNITE
DPEVVYKYIQAACLMNQFTEVERICRDNNVYNPEKVKNLLKEAKLADQLPLILVCDRYDF
VNDLVFYLFRNNMFQFIEIYVQRINPSKTPQVVGALLDIDCDEELVQNLLMSVVGQVPVD
ELVEEVERRNRLKLLLPYLESLLQSGSQDRAIYDALAKIYIDSNNNPEVFLKENNFYDTL
TVGKYCEKRDPYLAFIAYEKGGNDTEIINLCNENSMFKQLARYLLKRSDSNLWSEVLQDS
AYRRPLLDQVIATAVPESSDPEAVSIVVKALMEVDLPSQLIELLEKIVLQPSSFSENANL
QNLLFLTAIKADKSRVMEYIDKLDKYDVDEIAEIAIENGLYEEAFRIYKIHNKHEQAMKV
LVEDIVSLDRAQDYAETVEQPEVWSRLAKAQLDGIRIPDAIESYLKADDPSNYSEVIELA
SRAGKYEELIKYLLMARSKMHEPDVDSALLIAYAKTNQLTEMETFLIGSNVADVKAVGDE
CFESKNYEAAKLMYSSISNWSMLATTLVYLGEYQGAVDCARKANSIKVWKQVGTACIDKR
EFRLAQICGLNLIVHAEELPGLIRLYEERGYFEEVISLMEAGLGLERAHMAFYTELAILY
AKYKPERMMEHLKLFWGRLNMAKVIRACDQMHLWNEAVFLYVHDQSYDNAAAVMMEQPEA
FDHQSFKDIIVHVANLELYYRALNFYLEQHPMLLTDLLAALTPRIDHPRVIRIFEKSENT
PLILNFMVAIQHLNIQAVNHAYNDLLIEMEDYQSLQDSIENYDHFDAIALARRLEKHSLL
EFRRIAAYIYRKNKRWTQSIELSKQDRFYKDAIITARDSDQTTIAEDLMKYFVEIGNYEC
FAAILYTCYHLLRNDLVMEISWRKGLQDYAYPYFINFQCEMFSKVLNLEKDLKDRQAVKS
EEESASTIGAGILGNTLMLTQGPMANNNDQFDSFQQASPMPRLGNF
NT seq 5001 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacaattaccaatacggttcagtgaggtgttacagctcgcatccgtaggaatt
caaccgtcttctttcggatttgcaaatgtaacccttgaatctgacaaatatgtttgtgtt
cgcgataatccaaatggtgtaaaccaggtcgttattgtcgatttggaagatccatctaat
gtgttgcgacgtcctatttcggcagattcagttatcttacatcccaaaaagaaaattatt
gcattaaaagcacaaagacaacttcaagtattcgacttggaagcgaaagcgaaaattaat
agttatgtaatgaatcaagatgtcgtttactggacttggatcagcgatagcgttatcggt
atggtcactgacacttctgtgttccactggaccgtctccggctctgatcctgttaaaatg
tttgatcgtcatagctcattgaatggaacgcagatcatttcctacaagagcaactataat
gaagaatggtttacattgatcggtatttcctcccgggataaccgtattgctggcaatctt
caactgtattccaaaaagaggaaggtcagtcagcctctggaaagtcacgcttctgcattt
gcagtcattcaaccagaaggcgttgatcatgaagttcaagttttagcacttgccagtcga
ttacccacaggctcgaaacttagtattgttgaggtagaccgtaaccccaacaatcccgcg
tttgctaccaaaaccgtcgatcttttcttccctccggaagccgttaatgattttcctatt
gctattgaaattggttccacttataacgttgcttatgttgttaccaaatatggctttatt
catgtttatgatttggaaaccgcgaaatgcatttatatgaatcgtgtttcgggtgaatca
atctttgtaaccactgctcataaatctgtgaatggtcttatggccattaaccgaaagggt
caagttcttagcgtatccataaaccctgaaaccatcattccttatatcttgtctaatctt
aatgaccctggtttggcagtccgaatggcatctcatgctaatcttcccggagctgacaat
ttgtatatgcaacagttccagcagcttatggctcaaggaaactacagcgaggctgctaag
gtggctgcttcatctcctcgtggtattcttcgtacctctcaggtgattgatcaattcaag
cttattcaagctgctcctggtcaaattgctcctatcttacaatatttcggcactttgttg
gataagggtcctttgaatgaacatgaaacaattgaattggctcgtcctgtgcttgctcaa
aaccgtatccaacttcttgaaaaatggtatggtgaaaacaagttggcctgtacagaagcg
ttgggtgatttagttaaaccttacaacactcctttcgcattgaagatttacgaaactgcc
aatgtgccaaacaaggttgtcatgtgcttatcagagttgggagattttggcaagttggct
acttacacatctcagcaaaacatcactccggattacgtctctcttctccaaaaccttgtt
agagttaaccctgatcaagctgcggagtttgctactcaaatgttcaacagtaacccctcc
attaatttagagaagattgttgacattttcatgtctcagaatttagttcaacaagcgacc
gcatttttgttggatgctcttaaggatgacaatcctgaacattctcatcttcaaactcgt
cttcttgagattaatttaattaatgcccctcaagttgctgatgctattttgggtaaccaa
atgtttactcactttgatcgtgccgtaattgcttcgctttgcgagcgcgctggtttagta
caacgtgctttggagttgtatgataagcctgctgatattaagagagtgattgttcactca
aatttattgaatcctgaatggttgatgaattactttagcagattttcacctgacgaggtt
tatgattaccttcgtgaaatgcttcgctctaatcttcgtcaaaatcttcaaatagttgtc
caaattgctactcgttactcagaccttgttggtgctcaacgcatcattgagatgtttgaa
aagttcaagacttttgaaggattgtactattatttgggtagtattgtaaacatcactgaa
gatccagaagtcgtatataagtatatccaggctgcttgtttgatgaaccagtttactgaa
gttgaacgcatctgtcgtgacaacaatgtttacaaccctgagaaggttaagaacttgctc
aaagaagccaaattagcggatcagcttccccttattcttgtttgcgatcgttatgacttt
gtcaatgatttggttttctatcttttccgaaacaacatgtttcaatttattgaaatatac
gttcaacgtattaatccctctaagactcctcaagtggtaggtgctttgttagatattgat
tgcgatgaagaacttgtccaaaacctcttgatgtctgttgttgggcaggttcctgtggat
gagttggttgaagaagttgagagacgcaatcgccttaaacttttgctgccctatttggaa
tctcttttgcaatctggtagtcaagatcgtgctatttatgacgcacttgccaagatatat
attgattccaataacaatcctgaagtatttttgaaagaaaacaacttttatgatactctt
acggttggtaaatactgtgaaaagcgtgatccctatttggctttcatcgcttatgagaag
ggtggtaatgatactgaaatcattaacctatgtaacgaaaactcaatgttcaaacagtta
gctcgttatcttcttaagcgcagtgactctaacctttggtccgaggttttgcaagacagt
gcttaccgccgtcctttgttggaccaggttatcgcaactgcagttcccgaatcttcagat
cctgaagcagtttcaattgtagtgaaagctttaatggaagtagatcttccttcacagctc
attgaattattggagaagattgttttgcaaccttcatccttcagcgaaaatgccaatctt
caaaacttgttgtttttgactgccattaaagctgataaatcacgtgttatggagtatatc
gataagttggataagtacgatgtcgatgagattgccgaaattgctattgaaaatggcctt
tatgaagaggctttcagaatttacaagattcacaacaagcatgaacaggctatgaaggta
ttagttgaggacattgttagtctcgatcgtgctcaagactatgccgaaacagttgaacag
cctgaagtttggtctcgccttgctaaggcccaattggatggaattagaattccggatgct
attgaatcatatttgaaggcagatgatccttcgaattactcagaggtaattgaattagct
tctcgtgctggtaagtatgaggaattgatcaaatatcttttgatggcaagaagcaagatg
catgagcctgatgtcgatagcgctcttcttattgcctatgcaaagaccaaccaattgact
gaaatggaaaccttcttgatcggctctaacgttgctgatgtcaaggcagtcggtgatgaa
tgctttgaaagcaaaaactatgaggcagcaaagcttatgtattccagcatttccaattgg
tctatgcttgccactactttagtctatcttggagaatatcagggagctgttgattgtgct
cgtaaggccaattccattaaggtttggaaacaagttggtaccgcttgtatagacaagcgt
gagtttagacttgctcaaatttgtggtttgaatcttatcgtccatgctgaggaacttcct
ggcctcatccgactttacgaagagcgtggttatttcgaagaggttatctcgttaatggaa
gctggtttgggtttggagcgtgctcatatggctttctacaccgaactcgctattttatat
gctaaatacaagcccgagcgtatgatggagcatttgaaactgttctggggtagactcaat
atggccaaagttattagagcttgtgatcaaatgcatttgtggaatgaagctgttttctta
tatgttcatgaccaaagttacgataatgccgcagctgtgatgatggagcaacccgaggcg
tttgatcatcaatccttcaaggacattattgttcatgttgctaatctcgagctttattat
cgtgcacttaacttctatctggagcaacatcccatgcttctaactgatttgttagctgcc
cttactcctcgcatcgatcatcctcgtgtaattcgtatttttgagaaatccgaaaataca
ccacttattttgaactttatggttgccattcaacatcttaatattcaagctgttaaccat
gcctataatgacttacttattgagatggaagattaccaatccttgcaagattctattgag
aattatgatcattttgatgcgattgctttggccagacgtcttgagaagcattctttattg
gagtttagacgtatcgccgcttacatttatagaaagaacaaacgttggacacaatcaatt
gaactttccaagcaagaccgtttttacaaggatgccattattactgcccgcgattccgat
cagactaccattgccgaggatttaatgaagtactttgtggaaattggcaactatgagtgt
ttcgctgctattctatatacttgctatcacttgttgcgcaacgatttagtaatggaaatt
agctggcgtaagggcttacaagattacgcttacccctactttattaatttccaatgtgaa
atgttttcaaaagttctcaatttagaaaaggacttgaaggatcgacaagccgttaagtcg
gaagaggaatcagctagtacaattggtgccggaatacttggcaatacgttaatgcttacc
caaggacccatggctaacaataatgaccaatttgattctttccaacaagcatccccaatg
ccaagacttggtaatttttag

DBGET integrated database retrieval system