KEGG   Schizosaccharomyces pombe (fission yeast): SPAC27F1.03cHelp
Entry
SPAC27F1.03c      CDS       T00076                                 

Gene name
uch1
Definition
ubiquitin C-terminal hydrolase Uch1
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPAC27F1.03c (uch1)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SPAC27F1.03c (uch1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(4320807..4321475)
Genome map
AA seq 222 aa AA seqDB search
MWRPLENTPEVLEPYLQKIGVQDASVFDLFSLEEIPEYIPRPVHALLFVFPSSGTKTIYK
GSRILPKDSDKVLWYPQTIPNACGTIGLLHAVSNGELRRKVNENDFIKSLIRTAEGSSIE
ERAKLIEDSKELEALHAAFAGPPLEVEGSEEDVETDLHFICFVKGKSKDDNHFYELDGRQ
EGPVQHSEIESDLLNAEVLSVIKNYIQSIDSPFFSLVAITTP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggcctttagaaaatacaccagaggtgctggaaccttacttacaaaaaatcggt
gtacaagatgctagcgtttttgacctgttttcattagaggaaatccccgaatatatccct
cgtcctgtccatgctcttttattcgtttttccatcctcaggaacaaaaactatatataaa
ggatcacgaattttaccaaaggatagtgacaaagtcttgtggtaccctcaaacaattcca
aatgcttgcggaacgattggattgctacatgcggtttcgaatggagaacttagaagaaaa
gtcaatgaaaatgattttattaaaagtctaatcagaactgctgaaggttcatctatcgaa
gaaagggctaagcttatcgaggattcgaaagaacttgaagctttacatgcagcatttgct
ggtccacctttggaagtagaggggtctgaggaagatgtagaaactgatcttcattttatc
tgttttgtaaagggaaaatcaaaggacgacaatcatttttatgagctagacggccgccaa
gaggggcccgtgcaacattctgaaattgaaagtgatttactgaatgccgaagtactttca
gttattaaaaattatattcagagtattgattctcctttcttttctcttgtcgcaattacg
actccgtaa

DBGET integrated database retrieval system