KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29A4.08cHelp
Entry
SPAC29A4.08c      CDS       T00076                                 

Gene name
prp19, cwf8
Definition
ubiquitin-protein ligase E4
Orthology
K10599  
pre-mRNA-processing factor 19 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Spliceosome
Ubiquitin mediated proteolysis
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    SPAC29A4.08c (prp19)
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC29A4.08c (prp19)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPAC29A4.08c (prp19)
Spliceosome [BR:spo03041]
 Complex B
  Other components
   Prp19 complex
    SPAC29A4.08c (prp19)
 Complex C
   Prp19-CDC5 complex
    SPAC29A4.08c (prp19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(5133242..5133299,5133340..5133444,5133930..5135233)
Genome map
AA seq 488 aa AA seqDB search
MFCSISGETPKEPVISRVSGNVYEKRLIEQVIRETSKDPVTQQECTLEDLVPVKVPDFVR
PRPPSATSLPALLSLFQEEWDSVALEQFELRRNLTETKQELSTALYSLDAALRVISRLTK
ERDEAREALAKFSDNIGTVSSKTIEVQEVEMGESDDQLKTSLRSTVEKTFQELSSKRKRT
KLQPKWATDDAVSQLLQATPSTILENLETESTTSFFPSPENSSFVLCLHKDELLCLDIQS
NSTLKIFEGSALACCWLTSSKIAVATADAISIFEFPVSSSGLQSVGEPTSSIPIDEKVNF
LQAHPSGEYLLAASNEKCYIFSLKSQVYNITVAQHITSLAVHPDGNLFVAGLENGELRFF
ETSSGNELTKFGPHSSPVKTLQFGENGYWLVVTTNDDSDIFIWDLRKSELVQKIPLQTKV
AAVSLDITSQLLVSSDGETLYVHIYVKSSKSWRCMSQTHVSSISNLVWLNELHQLLFSTS
NGAILRLG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttttgctcaatcagtggagaaacgccaaaagaaccggtgatttctcgtgtaagtgga
aatgtttacgagaagcgcttgattgaacaagttattcgtgaaacgtctaaagaccctgtt
actcaacaggaatgcacgttggaggacttggttcctgtaaaggtacctgattttgttaga
cctcgacctccttctgccacttcattgcctgcattgctgtctctctttcaagaagaatgg
gattctgtcgcgcttgagcaatttgaacttagaagaaatcttacagagacgaagcaggag
ttatcaacggcattgtattcgctagatgctgcgttaagagttatatctcggcttaccaaa
gaaagagacgaagctagagaagcattggcgaaattttccgataacataggcactgtttcc
tcgaaaactattgaagtacaagaggtagagatgggcgaaagtgatgaccagcttaaaact
agcttacgctctacggtggaaaaaacatttcaagaactttcttccaaaaggaaacgtaca
aagttacaacctaaatgggcgactgacgatgctgtgagtcagctcttgcaagctactcct
tctactatcttagaaaatttggaaacagaaagcactacgtctttcttcccgtcccctgaa
aattcttcttttgtattatgtcttcataaggatgaacttttatgtctagatatccaatcc
aacagtactctcaaaatttttgaaggatcagctttagcgtgttgttggttgacttcttcc
aagattgctgtcgctactgctgatgccatttcaatttttgaatttcctgtttcctcatct
ggtttacaaagtgtgggtgaacctacttcgtccattcctatagacgaaaaggtgaacttc
cttcaagctcatccaagtggggaatatttattagcagcatcaaacgaaaagtgttatatt
ttctccctgaaatcccaggtttataatatcaccgttgctcaacacattacatctcttgct
gtacatccggacggtaacctctttgtcgctgggttagagaatggcgagttacgctttttt
gagacttcctcgggaaatgagcttacaaaatttggaccacattcaagtccagttaaaaca
ttacaatttggtgaaaacggttattggcttgtagtaacaactaatgatgactctgacatt
ttcatttgggacttaagaaaatctgagcttgttcaaaaaatacccctacaaaccaaagtc
gcagcagtgtcattagatattactagtcaacttttggtaagttcggatggggagactctc
tatgtacatatttatgtcaaatcttcaaagtcttggagatgtatgagtcaaacccatgtt
tcctctatttctaatttggtttggttaaatgagttacaccagttgttgtttagtacttca
aatggagccattctccggttgggttaa

DBGET integrated database retrieval system