KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29A4.20Help
Entry
SPAC29A4.20       CDS       T00076                                 

Gene name
elp3, kat9
Definition
elongator complex, histone acetyltransferase subunit Elp3 (predicted)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(5104524..5104605,5104701..5106253))
Genome map
AA seq 544 aa AA seqDB search
MSTSSLAFLKAKACAEIVAELIASENQNKVINLNALKMRISKKHQLSESPRLTDIIAAIP
PDAYLKESLMRKLRAKPVRTASGIAVVAVMCKPHRCPHIAMTGNVCVYCPGGPDSDFEYS
TQSYTGYEPTSMRAIRARYDPYEQARGRVEQLRSLGHTVDKVEYIIMGGTFMSLPESYRH
TFIANLHNALSGATTEDLDEAVKFSEQSETKCVGITIETRPDYCLDQHLDEMLRYGCTRL
EIGVQSVYEDVARDTNRGHTVKAVCETFQLAKDTGYKVVTHMMPDLPNVGMERDIFQFQE
YFENPAFRTDGLKLYPTLVIRGTGLYELWKTGRYKNYTPNALVDLIARILALVPPWTRIY
RIQRDIPMPLVSSGVETGNLRELALNRMRDLGTKCRDIRAREVGMQEVHHKIHPEQVELL
RRDYTANGGWETFLSYEDPKQDILIGLLRLRQCSDKTYRPEFTSQPTSLVRELHVYGSAV
PVHSRDPKKFQHQGFGTLLLEEAERIAKYEHGSKKISVISGVGVRKYYQKLGYTLDGPYM
SKWL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacttccagtttggcctttttaaaggccaaagcttgtgcagaaattgttgctgag
ctgattgcctctgaaaatcaaaacaaggtcatcaatttgaatgctttgaaaatgagaata
tcaaaaaaacatcaattatcggagtccccccgcctgaccgacattattgctgcaattcca
ccagatgcctaccttaaagaatcgttgatgaggaaactaagagcgaaaccagtacgtacc
gcctctggtatagcagttgttgcagtgatgtgcaaacctcatagatgtccacacattgcc
atgacaggaaacgtttgtgtttactgtccgggtggacctgattcagattttgaatactcg
acacagtcgtacactggttatgaaccaactagtatgcgtgcgattcgcgctcgttatgat
ccttatgaacaggctagaggacgtgttgagcaactgcggtcgttaggccacacagtcgat
aaagtagaatacattatcatgggcggtaccttcatgtcattacctgaatcctaccgtcac
acatttattgctaatttacacaatgctctttcaggagctacgactgaagatttagatgaa
gcagtcaaattttctgagcaatctgagacaaaatgtgttggcattactattgagacgcgt
cctgattattgcctagaccaacatttggatgaaatgcttcgttacggatgtactcgtttg
gaaattggtgtccaaagtgtttacgaggatgtcgccagagacaccaatagaggacatact
gttaaagctgtgtgcgaaacattccagttggctaaggatactggatacaaggtggttacg
catatgatgcctgatttgcctaatgttggtatggaaagagatatattccaatttcaagag
tactttgaaaaccctgcattccgtactgatggtttaaagctctatcctacattagttatt
cgtggtactggtttatatgaattatggaaaacgggaagatataaaaactatacccccaat
gccttggtggatcttattgctagaattctcgctttggtacctccatggacccgtatttac
cgtattcaaagagatatcccaatgccgcttgtaagttcaggcgtagaaacaggaaatctc
agagaacttgctttaaatagaatgcgagatttaggcacaaagtgtcgagacattcgtgct
cgtgaagtaggtatgcaagaagtgcatcataaaattcatcctgagcaagttgaattactt
cgccgagactatactgctaatggcggatgggaaacgtttttatcatatgaagatcccaaa
caagatatcttgattggtttgttacgacttcgccaatgttccgataagacatatcgacca
gaatttacttctcagcctacctcacttgttcgcgaacttcacgtgtatggcagtgccgtt
cctgttcacagtagagatccgaagaagttccaacatcaaggttttggaacattactttta
gaagaagccgagcggatagctaagtatgagcatggtagtaaaaagatcagtgtaatttcg
ggtgttggcgttcgaaaatattatcaaaaattgggatacacattggatggtccttacatg
tctaaatggctttag

DBGET integrated database retrieval system