KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29E6.01Help
Entry
SPAC29E6.01       CDS       T00076                                 

Gene name
pof11, mug156, SPAC30.05
Definition
F-box protein Pof11
Orthology
K03362  
F-box and WD-40 domain protein 1/11
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Module
SCF-BTRC complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(4402017..4402143,4402219..4402313,4402365..4403663)
Genome map
AA seq 506 aa AA seqDB search
MNQDDNGKNVVSKVSDLTSCSDFSTSSPVPCLNPLSHENNRIDLIRDLLASLSKEGVVAV
YNHVRSLLFTDFTEVFPEEVSLRVFSYLDQLDLCKCKLMSKRWKRLLEDPGIWKALYMQK
GWFVNENVLNEFEAWRRTHKFPQPRFENFLKQQNIIGPYGTMFLPQQFIFDSNGRPLLNW
SYLYKEHAHLDSNWRHGRFLVSTFNNPSIRFPADQDFRATLDSVYCVQYDDEIMVSGSKD
RTVSVWDVNSRFILYKLYGHSGSVLCLDFCRRRNLLVSGSSDSTIIIWDWQNRRPLKVYF
GHTDNVLGVVVSENYIISSSRDHTARVWRLDATSPAEACMHVLRGHLASVNSVQYSSKTG
LIVTASSDRTLRTWDITTGHCIRIIHAHQRGIACAQYNGKFIVSGSSDLTIRIFEASSGK
LLRMLQGHEDLIRTVRFNDEKIVSGGYDGTVRIWNFNTGEQHCVLHNSRNSRVFGLQFDH
RRIIACTHSSEILVWNFDDGLDCTFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggacgacaatggcaaaaatgtggttagcaaggtgtcagatttgacatcttgc
agtgatttcagtacctcaagtccggttccttgcctaaatccgctgtctcatgaaaataat
agaattgacttaattcgtgatctgttggcttccttatccaaagaaggggtagttgctgtt
tacaatcacgttcgttctctgttatttacagatttcacagaagtatttcctgaagaggtt
agtttgagggtgtttagttacttagatcagcttgatctatgtaagtgcaagcttatgtca
aagcgctggaagcgtctattggaagatcctggaatttggaaggctttatatatgcaaaag
ggttggtttgtaaatgaaaatgtgctaaatgaatttgaagcttggagaaggacacacaag
tttcctcaaccaagattcgaaaattttctaaagcagcaaaatatcataggaccctatggt
acaatgtttctaccgcaacagtttatcttcgactccaacggccggcccttgttaaactgg
tcctatctatacaaagaacacgcccatttggatagtaattggagacatggtagatttcta
gtatctacattcaataacccctctatacgcttccctgcagaccaggattttcgtgctaca
ttggatagtgtttattgtgttcaatatgatgacgaaatcatggtcagcgggtctaaagat
cgaacagtaagtgtgtgggatgtaaattctcgatttattctttataaattatacggccat
tctggaagcgtcctgtgtttggacttttgtagacgaagaaatcttcttgtttctggttct
tctgattcaacaattattatatgggattggcaaaaccgacgcccattaaaagtttatttc
ggacatacagataatgtgctaggtgtcgttgtatccgaaaattacattatatcttcttca
agggaccacacagctcgagtatggaggttagatgccacctcccctgctgaagcttgtatg
catgttttgcgtggtcatcttgcttctgtaaattctgtacaatattcttcgaaaactgga
ttaattgtcacagcaagcagcgatcgcactctacgcacttgggacataactactggccat
tgcattcgcattattcatgctcatcaacgtggaatagcatgtgctcaatataatggtaaa
tttattgtttcaggctcttcggaccttacaattaggatatttgaagcaagttccggtaaa
ctgcttcgtatgcttcaaggtcacgaagatttgatccgcactgtgcgatttaatgatgaa
aaaattgtttcaggcggttacgatggcactgttcgaatttggaatttcaacactggcgag
caacactgtgtattgcataatagtagaaattctcgtgtgttcggtctgcagtttgaccac
agacgtattattgcatgtactcatagtagcgagatattggtttggaattttgacgatgga
ttggattgtacatttttttag

DBGET integrated database retrieval system