KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2F3.03cHelp
Entry
SPAC2F3.03c       CDS       T00076                                 

Gene name
rpa49, rpa51
Definition
(RefSeq) DNA-directed RNA polymerase I complex subunit Rpa49 (predicted)
  KO
K03005  DNA-directed RNA polymerase I subunit RPA49
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo00240  Pyrimidine metabolism
spo01100  Metabolic pathways
spo03020  RNA polymerase
Module
spo_M00182  RNA polymerase I, eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPAC2F3.03c (rpa49)
   00240 Pyrimidine metabolism
    SPAC2F3.03c (rpa49)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    SPAC2F3.03c (rpa49)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     SPAC2F3.03c (rpa49)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_I_A49
Motif
Other DBs
NCBI-GeneID: 2541914
NCBI-ProteinID: NP_594382
PomBase: SPAC2F3.03c
UniProt: O14086
Position
I:complement(3925983..3927260)
Genome map
AA seq 425 aa AA seqDB search
MAGDELKGKKRKYRDSHSGDEKSVKILPLSESSLPPLVTTISGFYPPENTRFQLLKKSNQ
SNRDASLIGRTERVQFEAKNQSTATVEANYCLAVADKTGRVKKIVPAKYLNTFERNILAL
QEKDKFLKKKHGTVSGTVMEQRANLGLAFGTRKSQKAIMEESANRVKAETLGDVKDQLVS
NVQKATEALPTQEDIAAAQAQDRPIPPVNVGAESIEDAYKLEDIIPKEEFSAIYIKPLLE
NPDERNWAKLLPYRHSLFINERFQRLLSIEEVDQKRARILYYISLLQAFLFSRRSVGNRE
TLRKKLADPPEILIDGLIKRFTQTTGIGSVQVSSREVDKIICYILVLCLIVDNYSTDVLT
LANDLNVKTMKANELFRTVGCRIMAYTETQRMALGLNKTDAKNHKRAVLKIPLEFPKPRR
GRARN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgacgagttaaagggcaagaagcggaaatatagagattcccattccggtgat
gaaaaatccgttaagatattgcctttgagtgaatcgagtttaccaccacttgtcacgaca
atttccggattttatccacccgaaaatacccggttccagcttctcaaaaagagcaatcag
agcaacagagatgcgtcgttaattggaaggacagagcgtgttcaatttgaggctaaaaat
caatcaacggctacggttgaggcaaattactgtttagctgttgctgataaaactggtcgt
gtaaaaaagattgttccagcaaagtatcttaatacttttgaaagaaatattttggcactt
caggagaaggacaaatttttgaaaaagaagcatggaactgtaagcggtactgttatggaa
cagcgtgccaacttgggtttggcatttggtacaagaaaaagtcaaaaagctattatggaa
gagtccgccaatcgtgtcaaagctgaaactttgggagatgtcaaggatcaattggttagt
aatgttcaaaaagctactgaagcacttccaacgcaagaagatatcgctgctgctcaagcg
caagatcgccctattcctcctgtcaatgtcggtgctgaatccattgaagatgcatacaaa
ttggaggacattattcccaaagaagagttttcagctatttacattaagcctctgttagaa
aaccctgacgagcgcaattgggccaaattattgccgtaccgtcactccttgtttattaat
gaacgcttccagcgattactttccattgaggaggttgaccagaagcgggcgagaattttg
tattacatttctcttttgcaagcttttttgttttctcgtcgttctgtgggcaaccgtgaa
actttacgtaaaaaattggctgatccaccagagattcttattgatgggttgattaaacgt
tttactcaaaccaccggtattggtagcgtccaagtatcatctcgagaagttgataaaatc
atatgttatattctggtattgtgcttaatcgttgataattactcaactgatgttcttacc
ttggcaaatgacttgaatgtcaagaccatgaaggctaatgagctttttagaacggtgggt
tgtcgaattatggcttacaccgaaactcaaagaatggctttaggtcttaacaaaactgat
gctaaaaatcataagcgtgcagtattaaaaattcccctagagttccctaaacctcgacgt
ggacgcgctagaaattag

DBGET integrated database retrieval system