KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2F7.03cHelp
Entry
SPAC2F7.03c       CDS       T00076                                 

Gene name
pom1
Definition
DYRK family protein kinase Pom1 (EC:2.7.12.1)
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC2F7.03c (pom1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SPAC2F7.03c (pom1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   SPAC2F7.03c (pom1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(534462..537725)
Genome map
AA seq 1087 aa AA seqDB search
MGYLQSQKAVSLGDENTDALFKLHTSNRKSANMFGIKSELLNPSELSAVGSYSNDICPNR
QSSSSTAADTSPSTNASNTNISFPEQEHKDELFMNVEPKGVGSSMDNHAITIHHSTGNGL
LRSSFDHDYRQKNSPRNSIHRLSNISIGNNPIDFESSQQNNPSSLNTSSHHRTSSISNSK
SFGTSLSYYNRSSKPSDWNQQNNGGHLSGVISITQDVSSVPLQSSVFSSGNHAYHASMAP
KRSGSWRHTNFHSTSHPRAASIGNKSGIPPVPTIPPNIGHSTDHQHPKANISGSLTKSSS
ESKNLSTIQSPLKTSNSFFKELSPHSQITLSNVKNNHSHVGSQTKSHSFATPSVFDNNKP
VSSDNHNNTTTSSQVHPDSRNPDPKAAPKAVSQKTNVDGHRNHEAKHGNTVQNESKSQKS
SNKEGRSSRGGFFSRLSFSRSSSRMKKGSKAKHEDAPDVPAIPHAYIADSSTKSSYRNGK
KTPTRTKSRMQQFINWFKPSKERSSNGNSDSASPPPVPRLSITRSQVSREPEKPEEIPSV
PPLPSNFKDKGHVPQQRSVSYTPKRSSDTSESLQPSLSFASSNVLSEPFDRKVADLAMKA
INSKRINKLLDDAKVMQSLLDRACIITPVRNTEVQLINTAPLTEYEQDEINNYDNIYFTG
LRNVDKRRSADENTSSNFGFDDERGDYKVVLGDHIAYRYEVVDFLGKGSFGQVLRCIDYE
TGKLVALKIIRNKKRFHMQALVETKILQKIREWDPLDEYCMVQYTDHFYFRDHLCVATEL
LGKNLYELIKSNGFKGLPIVVIKSITRQLIQCLTLLNEKHVIHCDLKPENILLCHPFKSQ
VKVIDFGSSCFEGECVYTYIQSRFYRSPEVILGMGYGTPIDVWSLGCIIAEMYTGFPLFP
GENEQEQLACIMEIFGPPDHSLIDKCSRKKVFFDSSGKPRPFVSSKGVSRRPFSKSLHQV
LQCKDVSFLSFISDCLKWDPDERMTPQQAAQHDFLTGKQDVRRPNTAPARQKFARPPNIE
TAPIPRPLPNLPMEYNDHTLPSPKEPSNQASNLVRSSDKFPNLLTNLDYSIISDNGFLRK
PVEKSRP
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgggctatttgcagtcccaaaaagcggtttctctgggcgacgaaaatacggatgcatta
tttaaacttcatacatcaaaccggaaaagcgcaaacatgttcggaataaaatctgaacta
ttaaacccatctgaactttctgccgttggtagttattccaacgatatttgtccaaaccgc
cagagttctagcagtacagcagcagatacgagtccttcgacgaatgcctcaaatacgaac
atttcttttccggaacaagagcataaagatgagttatttatgaatgttgaaccaaaggga
gttggttcatctatggataatcatgctattactatacaccactcgactggcaatggttta
ctccgaagtagttttgatcacgattatagacagaaaaacagtccgaggaattccatacac
cgtttgtcaaacataagtattggtaataacccaatcgatttcgagtcatctcagcagaac
aatccttcgtcgttgaatacttcttcacatcataggacatcttcaatatcgaactctaag
agttttggaacttccttatcatattataatcgttcatcaaagcctagtgattggaatcag
caaaataatggggggcatttgagtggggttatatctattacacaagatgtatcatccgtt
cctttacaatctagcgttttttcctcggggaaccatgcataccatgcttcaatggctcca
aagagatccggtagttggcgtcatactaacttccattctacttcacatcccagagcagct
tctattggaaataagtctggaattcctcctgttccaactattcctcctaatataggtcat
tccactgatcaccaacatcctaaagcaaatatatctggatcccttacgaaatcaagttca
gaatcgaagaatctttctacaatccaatcccctttgaagacatccaattcttttttcaaa
gaactttccccccatagtcaaataaccctttctaatgttaaaaataatcactcacatgta
ggatcacaaaccaaatcacactcttttgctaccccctctgtcttcgataacaacaaacct
gtttcatccgataatcacaataatactactacatcatctcaagttcatcccgacagtaga
aatcctgatccgaaagctgctcctaaagcggtttctcagaagacaaacgttgatgggcat
cgtaaccatgaagctaaacatgggaatactgtccaaaatgagtctaaatcacagaaatct
tccaacaaagaaggtagatcttcaagaggtggcttttttagcagattgagtttttcgaga
agttcttctcgtatgaagaaaggaagtaaagctaaacacgaggatgcccctgacgtaccg
gcaataccacatgcttacatagctgattcttctaccaaatctagctaccggaatggaaag
aaaactcctacgagaacgaaaagccggatgcagcaatttattaactggttcaaaccatcc
aaagaaagaagctctaacggtaatagtgattctgcatcacctccccctgttccaagactt
tcgattacgcgttctcaggtttcccgtgaacctgagaagcccgaggaaattccttcagtt
cctccactaccttcaaactttaaagataaaggacatgtacctcagcaacgaagtgtttcg
tatactcctaaaaggagttctgatacgagtgaatcattacagccttccttatcttttgcg
tcttcaaatgtgttgtcagaaccgtttgatcgtaaggttgctgatttagctatgaaggcc
attaatagcaaacgaattaataagcttcttgacgatgcaaaagttatgcagtccctcctt
gaccgagcctgtataataactcctgtcagaaacacggaagttcaattgatcaacaccgct
cctttaacggagtatgagcaggatgaaataaacaactacgataacatatattttactggg
ttaagaaacgttgataaacgtcggtcagctgatgaaaacacctcttcgaattttgggttt
gacgacgaaagaggagattacaaggttgttttaggagaccatattgcttatcgatacgaa
gttgtggatttcttagggaaggggagttttggacaggttctacgttgtattgattacgaa
actggaaaacttgttgcattgaaaattatccgtaataaaaaacgctttcatatgcaagct
ctcgtcgaaacaaaaattttacaaaaaatccgcgagtgggacccattggatgagtactgt
atggttcaatatactgaccacttttatttccgcgatcatctttgcgttgctactgaatta
ttgggtaaaaacctttatgagttaattaaaagtaatgggtttaaaggacttccaatagta
gtcattaaaagcataacacggcaacttattcagtgcttaacacttttaaatgaaaagcac
gttattcattgtgatttgaaacccgaaaatattttactatgccacccatttaaatcacag
gtgaaggtgattgattttgggagtagctgctttgaaggtgaatgcgtttatacatacatt
caatctcggttttatcgttctccagaagtgatattgggtatgggttatggtacaccaata
gacgtttggagccttggatgcataatagcggaaatgtacactggatttcccttgtttcct
ggtgaaaacgagcaagagcaactcgcttgcattatggaaatttttggaccacctgatcat
tcgttgattgacaaatgctcacgaaaaaaggtgttttttgactcatctggaaagccaaga
ccatttgtatcatcgaaaggagtaagccgtcgtccttttagcaagtcccttcatcaagta
ttgcaatgcaaagacgtttcgtttttaagttttatatctgactgtctaaaatgggatcct
gatgaaagaatgactccacagcaagctgctcaacatgattttcttactggaaagcaagat
gttagaagacctaacactgcgccagctcgtcagaaatttgcgagacccccaaatatagaa
acagctccaattccgcgtcctttaccgaatttgccaatggaatacaatgaccatacctta
ccttccccgaaagagccctctaaccaagcttctaatcttgttcgctcttctgacaaattc
cccaatcttttgacaaatttagattattcaataatttcagataatggttttttacgaaag
ccggtagagaaatcccggccgtga

DBGET integrated database retrieval system