KEGG   Schizosaccharomyces pombe (fission yeast): SPAC30D11.13Help
Entry
SPAC30D11.13      CDS       T00076                                 

Gene name
hus5, ubc9
Definition
SUMO conjugating enzyme Hus5
Orthology
K10577  
ubiquitin-conjugating enzyme E2 I [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
RNA transport
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPAC30D11.13 (hus5)
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC30D11.13 (hus5)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPAC30D11.13 (hus5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(join(1094500..1094560,1094616..1094695,1094745..1094854,1094897..1094920,1095142..1095274,1095328..1095393))
Genome map
AA seq 157 aa AA seqDB search
MSSLCKTRLQEERKQWRRDHPFGFYAKPCKSSDGGLDLMNWKVGIPGKPKTSWEGGLYKL
TMAFPEEYPTRPPKCRFTPPLFHPNVYPSGTVCLSILNEEEGWKPAITIKQILLGIQDLL
DDPNIASPAQTEAYTMFKKDKVEYEKRVRAQARENAP
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctctttgtaaaacgcgtttgcaagaagaaaggaaacaatggagaagagatcat
ccatttggattctatgcaaaaccttgtaaatcatctgatggaggactcgatttaatgaat
tggaaggttggaattcccggaaaaccgaaaacgtcttgggaaggcggtttatacaaactc
acaatggcttttcctgaagaatatccaactcgtccccccaaatgtaggtttactccaccg
ttatttcatccaaacgtttatccttctggcaccgtttgtctctcaatacttaatgaagaa
gaaggctggaaaccggcaattacaattaagcagattttgctgggtattcaggatctttta
gatgatcctaatattgcctctcccgctcaaacagaagcatatacaatgttcaaaaaggat
aaagtcgagtacgaaaaacgagttcgtgctcaggctcgtgaaaatgctccataa

DBGET integrated database retrieval system