KEGG   Schizosaccharomyces pombe (fission yeast): SPAC31G5.08Help
Entry
SPAC31G5.08       CDS       T00076                                 

Gene name
ups1, ups
Definition
uroporphyrinogen-III synthase Ups1 (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC31G5.08 (ups1)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SPAC31G5.08 (ups1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:2999088..2999843
Genome map
AA seq 251 aa AA seqDB search
MKTALLLKTKSQPFDPYVEAFEKYGRDTAFIPVLRHKRVHEEQLRDKLKNVRKTYCGLIV
TSQRVSETLDEALKQEDETERQKILMETPIFTVGPATDDSIRRLGFQQTHGKDCGRGEVL
ADLIEEWYTTTKQHKPLLFLVGEKHRDIIQRKLGDDRVDSLIVYATQELENTETQIKDTI
RKHPTIDWIVAFSPTSICSLLNTFELKIATIGPTTGDYLKKLGTQPNVVSPAPNPESLAS
SIVAFDEENSS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgctttgctattgaaaaccaaatcacagcctttcgatccatatgtggaggcc
tttgaaaaatatggaagagatacagccttcattcctgtgctgagacacaaaagggttcac
gaagaacagcttagagataaattaaaaaacgttcgtaaaacttattgtggtttaatcgtt
accagtcaacgagttagcgaaactctggatgaagcattaaaacaagaagatgaaacggag
aggcagaaaatattgatggaaacaccaatatttacagtaggtccggcgactgatgatagt
attcgacgtctcggttttcagcaaacacatggaaaggactgtggaaggggtgaggttttg
gcagatttaattgaagagtggtatactacgactaaacaacataagcccttacttttcctt
gtaggggaaaagcatagggatataattcaaagaaaactgggggacgacagagtagattca
ttaatcgtatatgctacgcaagaattagaaaatacagaaacccaaataaaggatacgatt
agaaaacatcctacaattgattggattgtcgcattcagtccgacatccatttgctcttta
ttaaacacatttgaattaaagatcgcaaccattggacctactactggagattatctaaag
aagctgggaactcaaccgaacgttgtatctccagcacctaatccagagagcttggcatcc
agcatagttgcctttgatgaggagaattctagttga

DBGET integrated database retrieval system