KEGG   Schizosaccharomyces pombe (fission yeast): SPAC328.06Help
Entry
SPAC328.06        CDS       T00076                                 

Gene name
ubp2
Definition
ubiquitin C-terminal hydrolase Ubp2
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPAC328.06 (ubp2)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPAC328.06 (ubp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(3487325..3490684,3490769..3490834)
Genome map
AA seq 1141 aa AA seqDB search
MATVKNLRIGKSPNRLIQDLDVFDSPSAGWNDPWSPHSSRYHWQLHSNLGESAVFDENDF
WCVCQKTRKHLHVKVRRDRGKPLIEEPEENYGIKDRIPVYYEEEELPEPHVTSPTKSEFA
TTSTCMKWSSKTTKSEIEVEWRDSYLDANCIKEIIDSRRPSFASLLTKKSSSHQGSSHSS
QPSLFTTFTSLELFLRNVLVHNDQRAISAAPEGTFERHVGKGRQIQSLMKSLLFEYHHEN
VNYVPTIADAPLTDEQKLNLYLARNELIVLANHFRDTKEDPAIVANPFPVRLARPALINA
FGVPNYDSVVPMYTTVFRDNSASLPDDPAFIALGITNDYPDSFVRYFYEEQKKNDEANVR
VYADALAHIYNLRKSSFLRDLIAADRKNGIVSSDVIQAAYSSLGLEAEVGPDYRYSQEKI
FEAFHSALLRKPEFARAIRNDLETIGYARKSSEILNYVLSTEQAFYTVNEAYQWLGIKSN
TEDAMVASVALVKFEDDSDKAIEAVKWIAEERNSSILYDFLASQGRPSNKKPKEVPMDED
LAYNTLGVQDRALSDDVLINVYGFAVEDHPEQSDTLRAALKCIGEVRNSRLITHYLEHGN
LDIPPEVSSLDTPIGLENTGNLCYLNSLIQYYFIIKPLRNAILDIDENKDLNMIENKEAV
KKVGGRIVTRIEFLRALQFTYELRKLFIELITSKSSSVHPSSVLTYLALIPLTLDQVKSG
TSSVMDLSSSRELSNLNERSITIDPRAEEQAQGLEQEQGQDEAKSPAEQSSSVNLIDFPM
ANTNGESQTQPHYFEVSEEEINSSMDLGRQQDVLECIDHVLFQLEASLGRISNSEDRLGS
DNDLIRRLFSGKLKQTLNDASQGVRSNYEIFSHLIVDLFEEKQTLYDALDGVFETVNIDM
GSETAQRSLCITELPIILQLQIQRVQFDRTTGQPFKSNAFVEFGKELSMDRYVEDTDGKM
APLLQRYWDLKREIINLQKRQQLLLTTNSNLMSSVDTLSILSKWAAQQQDSRLPINPKLP
DILQEEINNVVAEVDMLKKQEASLKEERTHLFDNYISHSYDLLAVFVHRGQASFGHYWTY
IHDFENNVYRKYNDEYVTVVDESEIFADTTGNNANPYMLTYIRKEYRHIIECVHREHNLL
L
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtaaagaacttgcgaattggcaaaagtcctaatcggttgattcaagattta
gacgtctttgatagtccatcagctggatggaatgatccttggagtcctcatagctcaaga
tatcactggcagcttcattcaaatttaggcgagtccgctgtatttgacgagaatgacttt
tggtgtgtttgtcaaaaaactcgcaaacacttacatgtgaaagtccgaagagacaggggg
aagccattaattgaagagcctgaagaaaattatggaataaaagataggattcctgtttac
tacgaagaagaggaattacctgaacctcatgtgactagccctacgaaaagtgaattcgct
actacctctacttgtatgaaatggagtagcaaaacaacaaaaagtgaaattgaagttgaa
tggagagatagctatcttgatgctaattgtatcaaagagataattgattcccgacgtcca
tcatttgcttcccttttaactaaaaaatcgtcatctcatcaagggtcatcccattcatcc
caaccttctctttttactacatttacttctttggagttgtttttacgaaacgtgttggtc
cataacgatcaacgtgccattagcgctgccccggaaggaacttttgagagacatgtcgga
aagggccgccaaattcaatctttgatgaaatctcttctgtttgaatatcaccacgaaaat
gtaaattatgtccctaccattgcggacgctccccttactgacgaacaaaaacttaatcta
taccttgctaggaatgaacttattgttttggctaatcactttcgtgacactaaagaagat
ccggctattgttgctaacccttttcccgttaggttggctcgacctgctttaattaatgcc
tttggcgttcctaactatgatagcgtggttcccatgtataccacagtttttcgcgacaat
tcggcctccttacctgatgatcctgcttttatagccttgggtatcacgaatgattatcca
gacagctttgtccgttatttctatgaggaacaaaaaaagaacgatgaagctaatgttcgt
gtttatgcggatgcgcttgctcatatatacaatttacgtaaaagcagctttttgagagat
ctaattgcggcagataggaaaaatggaatcgtgtcgagcgatgtaatacaagccgcttat
tcgagtttaggacttgaagctgaggtaggcccggattacaggtatagtcaagaaaaaatc
tttgaggcgtttcattctgccctcctaagaaaacctgaatttgccagagctattaggaac
gatttggagactattggctatgcaagaaagagttctgaaattttaaattatgttttgtct
acagaacaggctttttatacggttaatgaagcctaccaatggttgggcattaagtctaac
accgaggacgccatggtagcttctgtggccttagtgaaatttgaagatgatagcgacaaa
gccatcgaggccgtcaaatggatagctgaagagagaaatagctccattttgtacgatttc
ttggcttcacaaggtagaccttccaacaagaagcctaaagaagtgcctatggatgaagat
ctagcttacaacacattaggtgttcaagatcgtgcactatcagatgacgttttaatcaat
gtatacggctttgctgttgaagaccacccagagcaatcagacactttgagagcagctttg
aaatgtataggagaagttaggaattcgcgtttaatcactcattatttagaacatggaaat
ctagatattccaccagaagtttcaagtttggatactccgatcggtttggaaaatactggt
aatctttgttatttgaattccctgatccaatactactttattataaaacctcttcgtaat
gcaattttggatattgatgaaaacaaagatcttaatatgattgaaaacaaggaagctgtc
aagaaagttggtggacggattgttactcgaattgaattcttgagggctttacaattcact
tatgaactccgaaaattatttattgaactcattacttcaaagtcatcgtctgttcatcct
tcttcagtactgacatatcttgctttaatacctcttacgttggaccaggtcaaatctgga
acatcctcggttatggatttgtcatcgtctcgagagttgagcaatttgaatgagagatct
atcactattgaccccagagcagaagagcaagctcaagggcttgaacaagaacaaggacag
gatgaggccaaaagtccagcggaacaatcttcatcagttaatttaattgattttcccatg
gccaatactaacggagagtctcaaacacaacctcattactttgaagtatctgaagaagaa
ataaactcctccatggatttaggtcgtcaacaagatgtcttggaatgtattgatcacgtt
ttgtttcaactggaagcttcacttggtcgtatttccaactcagaagatcgtcttggctct
gataatgatcttatacgacgtttgttttctggcaaactaaaacaaacactaaatgatgct
agtcaaggagtacggtctaactatgagattttttctcacttgatcgttgaccttttcgag
gagaaacaaacattgtatgatgcattggatggtgtttttgaaacagtcaatattgatatg
ggaagcgaaactgcccaacgatccttgtgtattactgagctaccgataattttgcaatta
caaatacagcgtgtccaatttgacaggactactggacagcctttcaagtctaatgcattt
gttgaatttggaaaagaactttccatggacagatatgttgaagatactgatgggaaaatg
gcacctttactacaaaggtactgggatctaaagcgtgaaattatcaaccttcaaaaacga
caacagctattgttaactacaaattcgaatctaatgtcatctgttgatacattgtctatt
ctatctaaatgggctgcacagcagcaggattcgagacttcctattaatccaaaacttcct
gatatccttcaagaggaaataaacaatgttgtcgctgaagtggatatgcttaaaaaacag
gaagccagcttaaaagaagaaaggacgcatcttttcgataattacatcagccatagctac
gacttgcttgctgtatttgtgcatcgtggacaggcttcattcggtcattattggacttac
attcatgatttcgaaaacaatgtgtatcgaaaatataatgatgaatatgttactgtggta
gatgaaagcgaaatttttgctgatactacgggcaacaatgctaacccttacatgcttacg
tacattaggaaagagtatcgacacataattgaatgtgttcaccgtgaacacaatcttctg
ctttaa

DBGET integrated database retrieval system