KEGG   Schizosaccharomyces pombe (fission yeast): SPAC343.03Help
Entry
SPAC343.03        CDS       T00076                                 

Gene name
apc11
Definition
anaphase-promoting complex subunit Apc11
Orthology
K03358  
anaphase-promoting complex subunit 11
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:spo04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1643108..1643126,1643170..1643292,1643510..1643652)
Genome map
AA seq 94 aa AA seqDB search
MKVKILRYHAIANWTWDTPKDDVCGICRVPFDGCCPQCTSPGDNCPIVWGKCKHIFHAHC
IQNWLATSGSQGQCPMDRQTFVVADSTNEKSETQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaaaatactgagataccatgcaattgctaactggacgtgggataccccaaaa
gacgacgtttgtggtatatgtcgtgttccattcgatggatgctgccctcaatgcacaagt
cctggagacaattgccccatagtttgggggaaatgcaagcatatatttcatgctcactgt
attcaaaactggttagctactagcggttctcaaggtcaatgcccgatggaccgtcaaact
tttgtggtagcagattctacgaatgaaaagtctgaaacacaataa

DBGET integrated database retrieval system