KEGG   Schizosaccharomyces pombe (fission yeast): SPAC343.03Help
Entry
SPAC343.03        CDS       T00076                                 

Gene name
apc11
Definition
anaphase-promoting complex subunit Apc11
Orthology
K03358  
anaphase-promoting complex subunit 11
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC343.03 (apc11)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC343.03 (apc11)
   04113 Meiosis - yeast
    SPAC343.03 (apc11)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     SPAC343.03 (apc11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1643108..1643126,1643170..1643292,1643510..1643652)
Genome map
AA seq 94 aa AA seqDB search
MKVKILRYHAIANWTWDTPKDDVCGICRVPFDGCCPQCTSPGDNCPIVWGKCKHIFHAHC
IQNWLATSGSQGQCPMDRQTFVVADSTNEKSETQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaaaatactgagataccatgcaattgctaactggacgtgggataccccaaaa
gacgacgtttgtggtatatgtcgtgttccattcgatggatgctgccctcaatgcacaagt
cctggagacaattgccccatagtttgggggaaatgcaagcatatatttcatgctcactgt
attcaaaactggttagctactagcggttctcaaggtcaatgcccgatggaccgtcaaact
tttgtggtagcagattctacgaatgaaaagtctgaaacacaataa

DBGET integrated database retrieval system