KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3A11.08Help
Entry
SPAC3A11.08       CDS       T00076                                 

Gene name
pcu4, Cul-4, cul4
Definition
cullin 4
Orthology
K10609  
cullin 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:spo03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:3453056..3455260
Genome map
AA seq 734 aa AA seqDB search
MPPEAKRIVVKGFDPRKSRQRQETYYVTMIDRLNMALQVVMAGLGLKTGYQELYSGVENL
TRADQASRCFNILQHHMSSGIQLLKDSAESFIQLEGTETDTNACTVVVGCWNKWLERVEI
VQNIFYYMDKTFLSHHPDYPTIEELSLSLFREKLMAVKNIQIPFLNSLLQSFENLHSSKS
TDHAYLQDAMLMLHRTEMYSSVFVPMYLVMLSRFYDTESSQKIQELPLEEYLEYAMSSLE
REDAYVEKFDIVRDKKSIRETVQRCLITSHLDTLTKGISQFIEKRDAHSCKLLYALLQFN
HETEYLIQPWSDCLVDVGFKLVNDESKDDTLVQELLSFHKFLQVVVDESFLHDETLSYAM
RKAFETFINGAKGSQREAPARLIAKYIDYLLRVGEQASGGKPLKEVFSEILDLFRYIASK
DIFEAYYKLDIAKRLLLNKSASAQNELMLLDMLKKTCGSQFTHSLEGMFRDVNISKEFTS
SFRHSKAAHNLHRDLYVNVLSQAYWPSYPESHIRLPDDMQQDLDCFEKFYLSKQVGKKIS
WYASLGHCIVKARFPLGNKELSISLFQACVLLQFNNCLGGEGISYQDLKKSTELSDIDLT
RTLQSLSCARIRPLVMVPKSKKPSPDTMFYVNEKFTDKLYRVKINQIYLKEERQENSDVQ
EQVVRDRQFELQASIVRVMKQKEKMKHDDLVQYVINNVKDRGIPLVSDVKTAIEKLLEKE
YLEREDNDIYTYVT
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcctccagaagcaaaacgtatcgtggttaaaggctttgacccacgaaagtcgaggcaa
agacaagagacctactatgtgacgatgatagatcgtttgaacatggctttgcaagtagtg
atggccggtttaggcttaaaaacaggttaccaagagttatattcgggagtcgaaaattta
acaagagcggatcaagcatctcggtgctttaacatcctacaacatcatatgtcttcagga
atccagcttttaaaggattctgcggagtcttttatacagcttgaagggactgaaacagac
actaatgcatgcaccgtagtagtagggtgttggaacaaatggttggaaagagtcgagatt
gttcaaaacatattctattacatggacaaaacatttctttctcaccatccagattacccg
acaatcgaagagctgtctctgtcactttttcgtgaaaagttgatggcagtcaaaaacata
caaattccctttttgaactctcttctccaaagctttgaaaatttacatagctctaaaagc
actgatcacgcctatttacaggatgcgatgttaatgctacatcgcacggaaatgtatagc
tctgtgtttgttcccatgtacttagttatgctaagccgtttttatgatacggagtctagc
caaaaaattcaagagctgcctttggaagagtacttggaatatgcgatgagttcgcttgag
cgggaggatgcctacgttgaaaagtttgatattgtgcgcgataaaaagtccattcgagag
actgttcaaaggtgtctaattacttcacatcttgacacactcacaaagggtataagtcag
ttcattgaaaaaagggatgcccattcttgtaaactactgtatgcattactgcaattcaat
catgaaaccgaatatttaattcagccctggtcggattgcttagtggacgttggtttcaag
ctcgttaacgatgaatcaaaggatgatactttggttcaagagctgttatcgttccacaaa
ttcttacaagtcgtggtggatgaaagtttccttcatgatgaaaccctttcgtatgccatg
cgaaaagccttcgagacgttcattaatggggcaaagggatctcaaagagaagctccagct
aggcttattgcaaaatacattgattatttgctacgagttggcgaacaggcttcagggggt
aagcctctgaaagaagtattttcggaaattttggatcttttccgctacatcgctagtaaa
gatatctttgaggcgtattacaagctggacattgcaaaacggcttctccttaataaatct
gcaagtgcgcaaaatgaattaatgcttctggatatgcttaagaaaacctgcggtagtcag
tttactcactctttggagggtatgtttcgagacgttaacatttcaaaagaatttacttct
tcttttcgtcactcaaaggctgctcataaccttcatagagatttgtatgttaacgtcttg
tcccaagcttactggccctcttatccagaatcacatatccggcttccagatgatatgcaa
caggatttggattgttttgaaaaattttacctttcaaagcaggttgggaaaaaaatcagt
tggtacgcttcgctaggacattgcatcgtaaaagcccgatttccactgggcaataaggaa
ctaagtatatcgcttttccaagcctgtgtcttacttcaattcaacaattgtttgggtgga
gaagggatttcgtatcaagatttgaaaaaatctacagagctctctgatatcgatttgact
cgtacattacagtccttgagttgtgctcgcattcggccattagtgatggttcccaaaagc
aaaaaacccagtccagacaccatgttttatgttaatgaaaagtttacagataagttatat
cgtgtaaaaattaaccaaatttatttaaaggaagagcggcaagaaaattctgatgttcaa
gaacaagtagtgagagatcgacagtttgagttgcaagccagtatcgttcgagtaatgaaa
caaaaggaaaaaatgaagcatgacgatttagttcaatacgttataaacaatgttaaggat
cggggaatacccttggtgtctgatgtgaaaactgccattgaaaaactactagagaaagag
tatctagaacgcgaggataatgatatttatacatatgtcacctaa

DBGET integrated database retrieval system