KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3A11.08Help
Entry
SPAC3A11.08       CDS       T00076                                 

Gene name
pcu4, Cul-4, cul4
Definition
cullin 4
Orthology
K10609  
cullin 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC3A11.08 (pcu4)
  Replication and repair
   03420 Nucleotide excision repair
    SPAC3A11.08 (pcu4)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     SPAC3A11.08 (pcu4)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      SPAC3A11.08 (pcu4)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      SPAC3A11.08 (pcu4)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPAC3A11.08 (pcu4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:3453056..3455260
Genome map
AA seq 734 aa AA seqDB search
MPPEAKRIVVKGFDPRKSRQRQETYYVTMIDRLNMALQVVMAGLGLKTGYQELYSGVENL
TRADQASRCFNILQHHMSSGIQLLKDSAESFIQLEGTETDTNACTVVVGCWNKWLERVEI
VQNIFYYMDKTFLSHHPDYPTIEELSLSLFREKLMAVKNIQIPFLNSLLQSFENLHSSKS
TDHAYLQDAMLMLHRTEMYSSVFVPMYLVMLSRFYDTESSQKIQELPLEEYLEYAMSSLE
REDAYVEKFDIVRDKKSIRETVQRCLITSHLDTLTKGISQFIEKRDAHSCKLLYALLQFN
HETEYLIQPWSDCLVDVGFKLVNDESKDDTLVQELLSFHKFLQVVVDESFLHDETLSYAM
RKAFETFINGAKGSQREAPARLIAKYIDYLLRVGEQASGGKPLKEVFSEILDLFRYIASK
DIFEAYYKLDIAKRLLLNKSASAQNELMLLDMLKKTCGSQFTHSLEGMFRDVNISKEFTS
SFRHSKAAHNLHRDLYVNVLSQAYWPSYPESHIRLPDDMQQDLDCFEKFYLSKQVGKKIS
WYASLGHCIVKARFPLGNKELSISLFQACVLLQFNNCLGGEGISYQDLKKSTELSDIDLT
RTLQSLSCARIRPLVMVPKSKKPSPDTMFYVNEKFTDKLYRVKINQIYLKEERQENSDVQ
EQVVRDRQFELQASIVRVMKQKEKMKHDDLVQYVINNVKDRGIPLVSDVKTAIEKLLEKE
YLEREDNDIYTYVT
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcctccagaagcaaaacgtatcgtggttaaaggctttgacccacgaaagtcgaggcaa
agacaagagacctactatgtgacgatgatagatcgtttgaacatggctttgcaagtagtg
atggccggtttaggcttaaaaacaggttaccaagagttatattcgggagtcgaaaattta
acaagagcggatcaagcatctcggtgctttaacatcctacaacatcatatgtcttcagga
atccagcttttaaaggattctgcggagtcttttatacagcttgaagggactgaaacagac
actaatgcatgcaccgtagtagtagggtgttggaacaaatggttggaaagagtcgagatt
gttcaaaacatattctattacatggacaaaacatttctttctcaccatccagattacccg
acaatcgaagagctgtctctgtcactttttcgtgaaaagttgatggcagtcaaaaacata
caaattccctttttgaactctcttctccaaagctttgaaaatttacatagctctaaaagc
actgatcacgcctatttacaggatgcgatgttaatgctacatcgcacggaaatgtatagc
tctgtgtttgttcccatgtacttagttatgctaagccgtttttatgatacggagtctagc
caaaaaattcaagagctgcctttggaagagtacttggaatatgcgatgagttcgcttgag
cgggaggatgcctacgttgaaaagtttgatattgtgcgcgataaaaagtccattcgagag
actgttcaaaggtgtctaattacttcacatcttgacacactcacaaagggtataagtcag
ttcattgaaaaaagggatgcccattcttgtaaactactgtatgcattactgcaattcaat
catgaaaccgaatatttaattcagccctggtcggattgcttagtggacgttggtttcaag
ctcgttaacgatgaatcaaaggatgatactttggttcaagagctgttatcgttccacaaa
ttcttacaagtcgtggtggatgaaagtttccttcatgatgaaaccctttcgtatgccatg
cgaaaagccttcgagacgttcattaatggggcaaagggatctcaaagagaagctccagct
aggcttattgcaaaatacattgattatttgctacgagttggcgaacaggcttcagggggt
aagcctctgaaagaagtattttcggaaattttggatcttttccgctacatcgctagtaaa
gatatctttgaggcgtattacaagctggacattgcaaaacggcttctccttaataaatct
gcaagtgcgcaaaatgaattaatgcttctggatatgcttaagaaaacctgcggtagtcag
tttactcactctttggagggtatgtttcgagacgttaacatttcaaaagaatttacttct
tcttttcgtcactcaaaggctgctcataaccttcatagagatttgtatgttaacgtcttg
tcccaagcttactggccctcttatccagaatcacatatccggcttccagatgatatgcaa
caggatttggattgttttgaaaaattttacctttcaaagcaggttgggaaaaaaatcagt
tggtacgcttcgctaggacattgcatcgtaaaagcccgatttccactgggcaataaggaa
ctaagtatatcgcttttccaagcctgtgtcttacttcaattcaacaattgtttgggtgga
gaagggatttcgtatcaagatttgaaaaaatctacagagctctctgatatcgatttgact
cgtacattacagtccttgagttgtgctcgcattcggccattagtgatggttcccaaaagc
aaaaaacccagtccagacaccatgttttatgttaatgaaaagtttacagataagttatat
cgtgtaaaaattaaccaaatttatttaaaggaagagcggcaagaaaattctgatgttcaa
gaacaagtagtgagagatcgacagtttgagttgcaagccagtatcgttcgagtaatgaaa
caaaaggaaaaaatgaagcatgacgatttagttcaatacgttataaacaatgttaaggat
cggggaatacccttggtgtctgatgtgaaaactgccattgaaaaactactagagaaagag
tatctagaacgcgaggataatgatatttatacatatgtcacctaa

DBGET integrated database retrieval system